| Product Number |
P100859_P050 |
| Product Page |
www.avivasysbio.com/pax2-antibody-middle-region-p100859-p050.html |
| Name |
PAX2 Antibody - middle region (P100859_P050) |
| Protein Size (# AA) |
417 amino acids |
| Molecular Weight |
45kDa |
| NCBI Gene Id |
5076 |
| Host |
Rabbit |
| Clonality |
Polyclonal |
| Concentration |
0.5 mg/ml |
| Gene Full Name |
Paired box 2 |
| Description |
|
| Alias Symbols |
FSGS7, PAPRS |
| Peptide Sequence |
Synthetic peptide located within the following region: DPVGSYSINGILGIPRSNGEKRKRDEDVSEGSVPNGDSQSGVDSLRKHLR |
| Product Format |
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Reference |
Bacchetta,J., (2008) Kidney Int. 73 (8), 977-978 |
| Description of Target |
PAX2 encodes paired box gene 2, one of many human homologues of the Drosophila melanogaster gene prd. The central feature of this transcription factor gene family is the conserved DNA-binding paired box domain. PAX2 is believed to be a target of transcriptional supression by the tumor supressor gene WT1. Mutations within PAX2 have been shown to result in optic nerve colobomas and renal hypoplasia. PAX2 encodes paired box gene 2, one of many human homologues of the Drosophila melanogaster gene prd. The central feature of this transcription factor gene family is the conserved DNA-binding paired box domain. PAX2 is believed to be a target of transcriptional supression by the tumor supressor gene WT1. Mutations within PAX2 have been shown to result in optic nerve colobomas and renal hypoplasia. Alternative splicing of this gene results in multiple transcript variants. |
| Protein Interactions |
BBS7; BBS4; BBS2; BBS1; RB1; BRCA1; SFRP2; PAXIP1; WT1; MAPK8IP1; MAPK8; ID2; |
| Reconstitution and Storage |
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles. |
| Enhanced Validation |
|
| Datasheets/Manuals |
Printable datasheet for anti-PAX2 (P100859_P050) antibody |
| Blocking Peptide |
For anti-PAX2 (P100859_P050) antibody is Catalog # AAP31220 |
| Immunogen |
The immunogen is a synthetic peptide directed towards the middle region of human PAX2 |
| Uniprot ID |
Q02962 |
| Protein Name |
Paired box protein Pax-2 |
| Protein Accession # |
NP_000269 |
| Purification |
Affinity Purified |
| Nucleotide Accession # |
NM_000278 |
| Tested Species Reactivity |
Human |
| Gene Symbol |
PAX2 |
| Predicted Species Reactivity |
Human, Mouse, Rat, Cow, Dog, Guinea Pig, Rabbit, Sheep, Zebrafish |
| Application |
IHC, WB |
| Predicted Homology Based on Immunogen Sequence |
Cow: 100%; Dog: 100%; Guinea Pig: 100%; Human: 100%; Mouse: 92%; Rabbit: 100%; Rat: 92%; Sheep: 100%; Zebrafish: 100% |
| Image 1 | Human Ovary Tumor
 | Host: Rabbit
Target Name: PAX2
Sample Tissue: Human Ovary Tumor
Antibody Dilution: 1ug/ml |
|
| Image 2 | Human Kidney
 | Rabbit Anti-PAX2 Antibody
Catalog Number: p100859
Paraffin Embedded Tissue: Human Kidney
Cellular Data: Epithelial cells of renal tubule
Antibody Concentration: 4.0-8.0 ug/ml
Magnification: 400X |
|
