POU3F2 Antibody - C-terminal region (P100858_P050)

Data Sheet
 
Product Number P100858_P050
Product Page www.avivasysbio.com/pou3f2-antibody-c-terminal-region-p100858-p050.html
Name POU3F2 Antibody - C-terminal region (P100858_P050)
Protein Size (# AA) 443 amino acids
Molecular Weight 47kDa
NCBI Gene Id 5454
Host Rabbit
Clonality Polyclonal
Concentration 0.5 mg/ml
Gene Full Name POU class 3 homeobox 2
Alias Symbols BRN2, OCT7, OTF7, OTF-7, POUF3, brn-2, oct-7, N-Oct3
Peptide Sequence Synthetic peptide located within the following region: QLEKEVVRVWFCNRRQKEKRMTPPGGTLPGAEDVYGGSRDTPPHHGVQTP
Product Format Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Reference Goodall,J., (2004) Mol. Cell. Biol. 24 (7), 2923-2931
Description of Target N-Oct-3 (POU3F2) is a protein belonging to a large family of transcription factors that bind to the octameric DNA sequence ATGCAAAT. Most of these proteins share a highly homologous region, referred to as the POU domain, which occurs in several mammalian transcription factors, including the octamer-binding proteins Oct1 (POU2F1) and Oct2 (POU2F2), and the pituitary protein Pit1 (PIT1). Class III POU genes are expressed predominantly in the CNS. It is likely that CNS-specific transcription factors such as these play an important role in mammalian neurogenesis by regulating their diverse patterns of gene expression. N-Oct-3 is a protein belonging to a large family of transcription factors that bind to the octameric DNA sequence ATGCAAAT. Most of these proteins share a highly homologous region, referred to as the POU domain, which occurs in several mammalian transcription factors, including the octamer-binding proteins Oct1 (POU2F1; MIM 164175) and Oct2 (POU2F2; MIM 164176), and the pituitary protein Pit1 (PIT1; MIM 173110). Class III POU genes are expressed predominantly in the CNS. It is likely that CNS-specific transcription factors such as these play an important role in mammalian neurogenesis by regulating their diverse patterns of gene expression.[supplied by OMIM].
Protein Interactions UBC; TBP; SOX10; POU3F2; PAX3; GTF2B; EP300; SOX11; PQBP1; POU3F4;
Reconstitution and Storage For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Datasheets/Manuals Printable datasheet for anti-POU3F2 (P100858_P050) antibody
Blocking Peptide For anti-POU3F2 (P100858_P050) antibody is Catalog # AAP31219 (Previous Catalog # AAPP01964)
Immunogen The immunogen is a synthetic peptide directed towards the C terminal region of human POU3F2
Uniprot ID P20265
Protein Name POU domain, class 3, transcription factor 2
Protein Accession # NP_005595
Purification Affinity Purified
Nucleotide Accession # NM_005604
Tested Species Reactivity Human
Gene Symbol POU3F2
Predicted Species Reactivity Human, Rat, Cow, Pig
Application WB
Predicted Homology Based on Immunogen Sequence Cow: 100%; Human: 100%; Pig: 100%; Rat: 100%
Image 1
Human 293T
WB Suggested Anti-POU3F2 Antibody Titration: 0.2-1 ug/ml
Positive Control: Transfected 293T
 

AVIVA SYSTEMS BIOLOGY manufactures and sells quality antibody products covering genome wide proteins.

AVIVA SYSTEMS BIOLOGY
10211 Pacific Mesa Blvd, Ste 401, San Diego, CA 92121 USA | Tel: (858)552-6979 | info@avivasysbio.com