Product Number |
P100858_P050 |
Product Page |
www.avivasysbio.com/pou3f2-antibody-c-terminal-region-p100858-p050.html |
Name |
POU3F2 Antibody - C-terminal region (P100858_P050) |
Protein Size (# AA) |
443 amino acids |
Molecular Weight |
47kDa |
NCBI Gene Id |
5454 |
Host |
Rabbit |
Clonality |
Polyclonal |
Concentration |
0.5 mg/ml |
Gene Full Name |
POU class 3 homeobox 2 |
Alias Symbols |
BRN2, OCT7, OTF7, OTF-7, POUF3, brn-2, oct-7, N-Oct3 |
Peptide Sequence |
Synthetic peptide located within the following region: QLEKEVVRVWFCNRRQKEKRMTPPGGTLPGAEDVYGGSRDTPPHHGVQTP |
Product Format |
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Reference |
Goodall,J., (2004) Mol. Cell. Biol. 24 (7), 2923-2931 |
Description of Target |
N-Oct-3 (POU3F2) is a protein belonging to a large family of transcription factors that bind to the octameric DNA sequence ATGCAAAT. Most of these proteins share a highly homologous region, referred to as the POU domain, which occurs in several mammalian transcription factors, including the octamer-binding proteins Oct1 (POU2F1) and Oct2 (POU2F2), and the pituitary protein Pit1 (PIT1). Class III POU genes are expressed predominantly in the CNS. It is likely that CNS-specific transcription factors such as these play an important role in mammalian neurogenesis by regulating their diverse patterns of gene expression. N-Oct-3 is a protein belonging to a large family of transcription factors that bind to the octameric DNA sequence ATGCAAAT. Most of these proteins share a highly homologous region, referred to as the POU domain, which occurs in several mammalian transcription factors, including the octamer-binding proteins Oct1 (POU2F1; MIM 164175) and Oct2 (POU2F2; MIM 164176), and the pituitary protein Pit1 (PIT1; MIM 173110). Class III POU genes are expressed predominantly in the CNS. It is likely that CNS-specific transcription factors such as these play an important role in mammalian neurogenesis by regulating their diverse patterns of gene expression.[supplied by OMIM]. |
Protein Interactions |
UBC; TBP; SOX10; POU3F2; PAX3; GTF2B; EP300; SOX11; PQBP1; POU3F4; |
Reconstitution and Storage |
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles. |
Datasheets/Manuals |
Printable datasheet for anti-POU3F2 (P100858_P050) antibody |
Blocking Peptide |
For anti-POU3F2 (P100858_P050) antibody is Catalog # AAP31219 (Previous Catalog # AAPP01964) |
Immunogen |
The immunogen is a synthetic peptide directed towards the C terminal region of human POU3F2 |
Uniprot ID |
P20265 |
Protein Name |
POU domain, class 3, transcription factor 2 |
Protein Accession # |
NP_005595 |
Purification |
Affinity Purified |
Nucleotide Accession # |
NM_005604 |
Tested Species Reactivity |
Human |
Gene Symbol |
POU3F2 |
Predicted Species Reactivity |
Human, Rat, Cow, Pig |
Application |
WB |
Predicted Homology Based on Immunogen Sequence |
Cow: 100%; Human: 100%; Pig: 100%; Rat: 100% |
Image 1 | Human 293T
 | WB Suggested Anti-POU3F2 Antibody Titration: 0.2-1 ug/ml Positive Control: Transfected 293T |
|
|