POU3F2 Antibody - C-terminal region (P100858_P050)

• Product Number: P100858_P050
• Name: POU3F2 Antibody - C-terminal region (P100858_P050)
• Protein Size (# AA): 443 amino acids
• Molecular Weight: 47kDa
• NCBI Gene Id: 5454
• Host: Rabbit
• Clonality: Polyclonal
• Concentration: 0.5 mg/ml
• Gene Full Name: POU class 3 homeobox 2
• Description:
  View product citations for POU3F2 Antibody - C-terminal region (P100858_P050)on CiteAb
• Alias Symbols: BRN2, OCT7, OTF7, OTF-7, POUF3, brn-2, oct-7, N-Oct3
• Peptide Sequence: Synthetic peptide located within the following region: QLEKEVVRVWFCNRRQKEKRMTPPGGTLPGAEDVYGGSRDTPPHHGVQTP
• Product Format: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Reference: Goodall,J., (2004) Mol. Cell. Biol. 24 (7), 2923-2931
• Description of Target: N-Oct-3 (POU3F2) is a protein belonging to a large family of transcription factors that bind to the octameric DNA sequence ATGCAAAT. Most of these proteins share a highly homologous region, referred to as the POU domain, which occurs in several mammalian transcription factors, including the octamer-binding proteins Oct1 (POU2F1) and Oct2 (POU2F2), and the pituitary protein Pit1 (PIT1). Class III POU genes are expressed predominantly in the CNS. It is likely that CNS-specific transcription factors such as these play an important role in mammalian neurogenesis by regulating their diverse patterns of gene expression. N-Oct-3 is a protein belonging to a large family of transcription factors that bind to the octameric DNA sequence ATGCAAAT. Most of these proteins share a highly homologous region, referred to as the POU domain, which occurs in several mammalian transcription factors, including the octamer-binding proteins Oct1 (POU2F1; MIM 164175) and Oct2 (POU2F2; MIM 164176), and the pituitary protein Pit1 (PIT1; MIM 173110). Class III POU genes are expressed predominantly in the CNS. It is likely that CNS-specific transcription factors such as these play an important role in mammalian neurogenesis by regulating their diverse patterns of gene expression.[supplied by OMIM].
• Protein Interactions: UBC; TBP; SOX10; POU3F2; PAX3; GTF2B; EP300; SOX11; PQBP1; POU3F4;
• Reconstitution and Storage: For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
• Blocking Peptide: For anti-POU3F2 (P100858_P050) antibody is Catalog # AAP31219 (Previous Catalog # AAPP01964)
• Immunogen: The immunogen is a synthetic peptide directed towards the C terminal region of human POU3F2
• Uniprot ID: P20265
• Protein Name: POU domain, class 3, transcription factor 2
• Protein Accession #: NP_005595
• Purification: Affinity Purified
• Nucleotide Accession #: NM_005604
• Tested Species Reactivity: Human
• Gene Symbol: POU3F2
• Predicted Species Reactivity: Human, Rat, Cow, Pig
• Application: WB
• Predicted Homology Based on Immunogen Sequence: Cow: 100%; Human: 100%; Pig: 100%; Rat: 100%
• Image 1: Human 293T
  
  WB Suggested Anti-POU3F2 Antibody Titration: 0.2-1 ug/ml
  Positive Control: Transfected 293T