| Product Number |
P100855_P050 |
| Product Page |
www.avivasysbio.com/elk3-antibody-middle-region-p100855-p050.html |
| Name |
ELK3 Antibody - middle region (P100855_P050) |
| Protein Size (# AA) |
407 amino acids |
| Molecular Weight |
44kDa |
| NCBI Gene Id |
2004 |
| Host |
Rabbit |
| Clonality |
Polyclonal |
| Concentration |
0.5 mg/ml |
| Gene Full Name |
ELK3, ETS-domain protein (SRF accessory protein 2) |
| Description |
|
| Alias Symbols |
ERP, NET, SAP2, SAP-2 |
| Peptide Sequence |
Synthetic peptide located within the following region: RTVIRFVTNKTDKHVTRPVVSLPSTSEAAAASAFLASSVSAKISSLMLPN |
| Product Format |
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Reference |
Wasylyk,C., (2008) Cancer Res. 68 (5), 1275-1283 |
| Description of Target |
ELK3 is a member of the ETS-domain transcription factor family and the ternary complex factor (TCF) subfamily. Proteins in this subfamily regulate transcription when recruited by serum response factor to bind to serum response elements. ELK3 is activated by signal-induced phosphorylation; studies in rodents suggest that it is a transcriptional inhibitor in the absence of Ras, but activates transcription when Ras is present.The protein encoded by this gene is a member of the ETS-domain transcription factor family and the ternary complex factor (TCF) subfamily. Proteins in this subfamily regulate transcription when recruited by serum response factor to bind to serum response elements. This protein is activated by signal-induced phosphorylation; studies in rodents suggest that it is a transcriptional inhibitor in the absence of Ras, but activates transcription when Ras is present. Publication Note: This RefSeq record includes a subset of the publications that are available for this gene. Please see the Entrez Gene record to access additional publications. PRIMARYREFSEQ_SPAN PRIMARY_IDENTIFIER PRIMARY_SPAN COMP 1-619 Z36715.1 1-619 620-2180 BC017371.1 549-2109 |
| Protein Interactions |
APP; TOP1; UBC; PIAS1; MAPK9; CTBP1; MAPK8; ID2; MAPK14; TCF3; |
| Reconstitution and Storage |
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles. |
| Datasheets/Manuals |
Printable datasheet for anti-ELK3 (P100855_P050) antibody |
| Blocking Peptide |
For anti-ELK3 (P100855_P050) antibody is Catalog # AAP31214 (Previous Catalog # AAPP01959) |
| Immunogen |
The immunogen is a synthetic peptide directed towards the middle region of human ELK3 |
| Uniprot ID |
P41970 |
| Protein Name |
ETS domain-containing protein Elk-3 |
| Protein Accession # |
NP_005221 |
| Purification |
Affinity Purified |
| Nucleotide Accession # |
NM_005230 |
| Tested Species Reactivity |
Human |
| Gene Symbol |
ELK3 |
| Predicted Species Reactivity |
Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Rabbit |
| Application |
WB |
| Predicted Homology Based on Immunogen Sequence |
Cow: 92%; Dog: 84%; Guinea Pig: 78%; Horse: 78%; Human: 100%; Mouse: 92%; Rabbit: 92%; Rat: 92% |
| Image 1 | Human Liver
 | WB Suggested Anti-ELK3 Antibody Titration: 0.2-1 ug/ml
ELISA Titer: 1:12500
Positive Control: Human Liver |
|
