HLX1 Antibody - middle region (P100839_T100)

Data Sheet
 
Product Number P100839_T100
Product Page www.avivasysbio.com/hlx1-antibody-middle-region-p100839-t100.html
Name HLX1 Antibody - middle region (P100839_T100)
Protein Size (# AA) 488 amino acids
Molecular Weight 51kDa
NCBI Gene Id 3142
Host Rabbit
Clonality Polyclonal
Concentration 1.0 mg/ml
Gene Full Name H2.0-like homeobox
Description
Alias Symbols HB24, HLX1
Peptide Sequence Synthetic peptide located within the following region: PGPYAVLTKDTMPQTYKRKRSWSRAVFSNLQRKGLEKRFEIQKYVTKPDR
Product Format Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Reference Kennedy, M.A., et al., (1994) Genomics 22 (2), 348-355.
Description of Target H2.0-like homeo box 1; H2.0 (Drosophilia)-like homeo box-1.
Protein Interactions UBC;
Reconstitution and Storage For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Datasheets/Manuals Printable datasheet for anti-HLX (P100839_T100) antibody
Other Applications Image 1 Data Sample Type: Xenopus Laevis embryo stage 46 gut tissue
Primary Dilution: 1:200
Blocking Peptide For anti-HLX (P100839_T100) antibody is Catalog # AAP31195 (Previous Catalog # AAPP01938)
Immunogen The immunogen is a synthetic peptide directed towards the middle region of human HLX1
Uniprot ID Q14774
Protein Name H2.0-like homeobox protein
Publications

Homeobox gene HLX is a regulator of HGF/c-met-mediated migration of human trophoblast-derived cell lines. Biol Reprod. 83, 676-83 (2010). 20554918

The H2.0-like homeobox transcription factor modulates yolk sac vascular remodeling in mouse embryos. Arterioscler Thromb Vasc Biol. 34, 1468-76 (2014). 24764455

Protein Accession # NP_068777
Purification Protein A purified
Nucleotide Accession # NM_021958
Tested Species Reactivity Human, Frog
Gene Symbol HLX
Predicted Species Reactivity Zebrafish
Application IF, WB
Predicted Homology Based on Immunogen Sequence Zebrafish: 92%
Image 1
Human Ovary Tumor
Host: Rabbit
Target Name: HLX1
Sample Tissue: Human Ovary Tumor
Antibody Dilution: 1.0ug/ml
Image 2
Xenopus Laevis
Sample Type: Xenopus Laevis embryo stage 46 gut tissue Primary Dilution: 1:200
 

AVIVA SYSTEMS BIOLOGY manufactures and sells quality antibody products covering genome wide proteins.

AVIVA SYSTEMS BIOLOGY
6370 Nancy Ridge Dr., Suite 104, San Diego, CA 92121 USA | Tel: (858)552-6979 | info@avivasysbio.com