GCM1 Antibody - C-terminal region (P100837_P050)

Data Sheet
 
Product Number P100837_P050
Product Page www.avivasysbio.com/gcm1-antibody-c-terminal-region-p100837-p050.html
Name GCM1 Antibody - C-terminal region (P100837_P050)
Protein Size (# AA) 436 amino acids
Molecular Weight 49kDa
NCBI Gene Id 8521
Host Rabbit
Clonality Polyclonal
Concentration 0.5 mg/ml
Gene Full Name Glial cells missing homolog 1 (Drosophila)
Description
Alias Symbols GCMA, hGCMa
Peptide Sequence Synthetic peptide located within the following region: DFNSYVQSPAYHSPQEDPFLFTYASHPHQQYSLPSKSSKWDFEEEMTYLG
Product Format Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Reference Chuang,H.C., et al., (2006) (er) Nucleic Acids Res. 34 (5), 1459-1469
Description of Target GCM1 is a DNA-binding protein with a gcm-motif (glial cell missing motif). GCM1 is a homolog of the Drosophila glial cells missing gene (gcm). This protein binds to the GCM-motif (A/G)CCCGCAT, a novel sequence among known targets of DNA-binding proteins.
Protein Interactions FBXW2; UBC; SENP1; CAMK1; SUMO1; DUSP23; CREBBP; HDAC5; HDAC4; HDAC3; HDAC1; CUL1; SKP1; UBE2I;
Reconstitution and Storage For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Datasheets/Manuals Printable datasheet for anti-GCM1 (P100837_P050) antibody
Blocking Peptide For anti-GCM1 (P100837_P050) antibody is Catalog # AAP31193 (Previous Catalog # AAPP01936)
Immunogen The immunogen is a synthetic peptide directed towards the C terminal region of human GCM1
Uniprot ID Q9NP62
Protein Name Chorion-specific transcription factor GCMa
Publications

Drewlo, S., Czikk, M., Baczyk, D., Lye, S. & Kingdom, J. Glial cell missing-1 mediates over-expression of tissue inhibitor of metalloproteinase-4 in severe pre-eclamptic placental villi. Hum. Reprod. 26, 1025-34 (2011). 21406447

Protein Accession # NP_003634
Purification Affinity Purified
Nucleotide Accession # NM_003643
Tested Species Reactivity Human
Gene Symbol GCM1
Predicted Species Reactivity Human, Dog, Horse, Rabbit
Application WB
Predicted Homology Based on Immunogen Sequence Dog: 90%; Horse: 92%; Human: 100%; Rabbit: 81%
Image 1
Human HepG2
WB Suggested Anti-GCM1 Antibody Titration: 0.2-1 ug/ml
Positive Control: HepG2 cell lysate
 

AVIVA SYSTEMS BIOLOGY manufactures and sells quality antibody products covering genome wide proteins.

AVIVA SYSTEMS BIOLOGY
6370 Nancy Ridge Dr., Suite 104, San Diego, CA 92121 USA | Tel: (858)552-6979 | info@avivasysbio.com