GCM1 Antibody - N-terminal region (P100836_P050)

Data Sheet
 
Product Number P100836_P050
Product Page www.avivasysbio.com/gcm1-antibody-n-terminal-region-p100836-p050.html
Name GCM1 Antibody - N-terminal region (P100836_P050)
Gene Symbol GCM1
Alias Symbols GCMA, hGCMa
Protein Size (# AA) 436 amino acids
Molecular Weight 49kDa
Product Format Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
NCBI Gene Id 8521
Host Rabbit
Clonality Polyclonal
Concentration Batch dependent within range: 100 ul at 0.5 - 1 mg/ml
Official Gene Full Name Glial cells missing homolog 1 (Drosophila)
Peptide Sequence Synthetic peptide located within the following region: MEPDDFDSEDKEILSWDINDVKLPQNVKKTDWFQEWPDSYAKHIYSSEDK
Target Reference Yu,C., et al., (2002) J. Biol. Chem. 277 (51), 50062-50068
Description of Target GCM1 is a DNA-binding protein with a gcm-motif (glial cell missing motif). The encoded protein is a homolog of the Drosophila glial cells missing gene (gcm). This protein binds to the GCM-motif (A/G)CCCGCAT, a novel sequence among known targets of DNA-binding proteins. The N-terminal DNA-binding domain confers the unique DNA-binding activity of this protein.This gene encodes a DNA-binding protein with a gcm-motif (glial cell missing motif). The encoded protein is a homolog of the Drosophila glial cells missing gene (gcm). This protein binds to the GCM-motif (A/G)CCCGCAT, a novel sequence among known targets of DNA-binding proteins. The N-terminal DNA-binding domain confers the unique DNA-binding activity of this protein. Publication Note: This RefSeq record includes a subset of the publications that are available for this gene. Please see the Entrez Gene record to access additional publications. PRIMARYREFSEQ_SPAN PRIMARY_IDENTIFIER PRIMARY_SPAN COMP 1-132 D88613.1 1-132 133-2763 AB026493.1 1-2631
Protein Interactions FBXW2; UBC; SENP1; CAMK1; SUMO1; DUSP23; CREBBP; HDAC5; HDAC4; HDAC3; HDAC1; CUL1; SKP1; UBE2I;
Reconstitution and Storage For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Datasheets/Manuals Printable datasheet for anti-GCM1 (P100836_P050) antibody
Blocking Peptide For anti-GCM1 (P100836_P050) antibody is Catalog # AAP31192 (Previous Catalog # AAPP01935)
Immunogen The immunogen is a synthetic peptide directed towards the N terminal region of human GCM1
Complete computational species homology data Anti-GCM1 (P100836_P050)
Tissue Tool Find tissues and cell lines supported by DNA array analysis to express GCM1.
Swissprot Id Q9NP62
Protein Name Chorion-specific transcription factor GCMa
Publications

Baczyk, D. et al. Glial cell missing-1 transcription factor is required for the differentiation of the human trophoblast. Cell Death Differ. 16, 719-27 (2009). IHC, WB, Dog, Human, Mouse, Rat 19219068

Bailey, LJ; Alahari, S; Tagliaferro, A; Post, M; Caniggia, I; Augmented trophoblast cell death in preeclampsia can proceed via ceramide-mediated necroptosis. 8, e2590 (2017). IHC, WB, Dog, Human, Mouse, Rat 28151467

Kumar, P., Luo, Y., Tudela, C., Alexander, J. M. & Mendelson, C. R. The c-Myc-regulated microRNA-17~92 (miR-17~92) and miR-106a~363 clusters target hCYP19A1 and hGCM1 to inhibit human trophoblast differentiation. Mol. Cell. Biol. 33, 1782-96 (2013). IHC, WB, Dog, Human, Mouse, Rat 23438603

Moretto Zita, M; Soncin, F; Natale, D; Pizzo, D; Parast, M; Gene Expression Profiling Reveals a Novel Regulatory Role for Sox21 Protein in Mouse Trophoblast Stem Cell Differentiation. 290, 30152-62 (2015). IHC, WB, Dog, Human, Mouse, Rat 26491013

Sivasubramaniyam, T. et al. Where polarity meets fusion: role of Par6 in trophoblast differentiation during placental development and preeclampsia. Endocrinology 154, 1296-309 (2013). IHC, WB, Dog, Human, Mouse, Rat 23341197

Protein Accession # NP_003634
Purification Affinity Purified
RNA Seq Find tissues and cell lines supported by RNA-seq analysis to express GCM1.
Nucleotide Accession # NM_003643
Replacement Item This antibody may replace item sc-101173, HPA011343
Tested Species Reactivity Human
Predicted Species Reactivity Human
Application IHC, WB
Predicted Homology Based on Immunogen Sequence Dog: 78%; Human: 92%; Mouse: 78%; Rat: 78%
Image 1
Human Lung
Human Lung
Image 2
Human Spleen
Human Spleen
Image 3
Human 293T
Host: Rabbit
Target Name: GCM1
Sample Tissue: Human 293T
Antibody Dilution: 1.0ug/ml
Image 4
Human THP-1 Whole Cell
Host: Rabbit
Target Name: GCM1
Sample Tissue: Human THP-1 Whole Cell
Antibody Dilution: 0.5ug/ml
 

AVIVA SYSTEMS BIOLOGY manufactures and sells quality antibody products covering genome wide proteins.

AVIVA SYSTEMS BIOLOGY
7700 Ronson Road, Ste 100, San Diego, CA 92111 USA | Tel: (858)552-6979 | info@avivasysbio.com