Product Number |
P100830_T100 |
Product Page |
www.avivasysbio.com/evx1-antibody-n-terminal-region-p100830-t100.html |
Name |
EVX1 Antibody - N-terminal region (P100830_T100) |
Protein Size (# AA) |
407 amino acids |
Molecular Weight |
42kDa |
NCBI Gene Id |
2128 |
Host |
Rabbit |
Clonality |
Polyclonal |
Concentration |
1.0 mg/ml |
Gene Full Name |
Even-skipped homeobox 1 |
Description |
|
Alias Symbols |
EVX-1 |
Peptide Sequence |
Synthetic peptide located within the following region: AGSAAGPGAEPQVAGAAMLGPGPPAPSVDSLSGQGQPSSSDTESDFYEEI |
Product Format |
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Reference |
Scherer, S.W., et al., (2003) Science 300 (5620), 767-772 |
Description of Target |
EVX1 is a member of the vertebrate eve-related homeo box family. This protein acts as a transcriptional repressor. A similar protein in mice is critical for early embryogenesis. |
Protein Interactions |
RAD21; |
Reconstitution and Storage |
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles. |
Datasheets/Manuals |
Printable datasheet for anti-EVX1 (P100830_T100) antibody |
Blocking Peptide |
For anti-EVX1 (P100830_T100) antibody is Catalog # AAP31183 (Previous Catalog # AAPP01926) |
Immunogen |
The immunogen is a synthetic peptide directed towards the N terminal region of human EVX1 |
Uniprot ID |
P49640 |
Protein Name |
Homeobox even-skipped homolog protein 1 |
Protein Accession # |
NP_001980 |
Purification |
Protein A purified |
Nucleotide Accession # |
NM_001989 |
Tested Species Reactivity |
Human |
Gene Symbol |
EVX1 |
Predicted Species Reactivity |
Human, Mouse, Rat, Cow, Dog, Guinea Pig, Rabbit |
Application |
IHC, WB |
Predicted Homology Based on Immunogen Sequence |
Cow: 100%; Dog: 100%; Guinea Pig: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100% |
Image 1 | Human kidney
| Human kidney |
| Image 2 | Human Lung
| Human Lung |
| Image 3 | Human Fetal Lung
| Host: Rabbit Target Name: EVX1 Sample Tissue: Human Fetal Lung Antibody Dilution: 1.0ug/ml |
|
|