| Product Number |
P100830_T100 |
| Product Page |
www.avivasysbio.com/evx1-antibody-n-terminal-region-p100830-t100.html |
| Name |
EVX1 Antibody - N-terminal region (P100830_T100) |
| Protein Size (# AA) |
407 amino acids |
| Molecular Weight |
42kDa |
| NCBI Gene Id |
2128 |
| Host |
Rabbit |
| Clonality |
Polyclonal |
| Concentration |
1.0 mg/ml |
| Gene Full Name |
Even-skipped homeobox 1 |
| Description |
|
| Alias Symbols |
EVX-1 |
| Peptide Sequence |
Synthetic peptide located within the following region: AGSAAGPGAEPQVAGAAMLGPGPPAPSVDSLSGQGQPSSSDTESDFYEEI |
| Product Format |
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Reference |
Scherer, S.W., et al., (2003) Science 300 (5620), 767-772 |
| Description of Target |
EVX1 is a member of the vertebrate eve-related homeo box family. This protein acts as a transcriptional repressor. A similar protein in mice is critical for early embryogenesis. |
| Protein Interactions |
RAD21; |
| Reconstitution and Storage |
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles. |
| Datasheets/Manuals |
Printable datasheet for anti-EVX1 (P100830_T100) antibody |
| Blocking Peptide |
For anti-EVX1 (P100830_T100) antibody is Catalog # AAP31183 (Previous Catalog # AAPP01926) |
| Immunogen |
The immunogen is a synthetic peptide directed towards the N terminal region of human EVX1 |
| Uniprot ID |
P49640 |
| Protein Name |
Homeobox even-skipped homolog protein 1 |
| Protein Accession # |
NP_001980 |
| Purification |
Protein A purified |
| Nucleotide Accession # |
NM_001989 |
| Tested Species Reactivity |
Human |
| Gene Symbol |
EVX1 |
| Predicted Species Reactivity |
Human, Mouse, Rat, Cow, Dog, Guinea Pig, Rabbit |
| Application |
IHC, WB |
| Predicted Homology Based on Immunogen Sequence |
Cow: 100%; Dog: 100%; Guinea Pig: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100% |
| Image 1 | Human kidney
 | Human kidney |
| | Image 2 | Human Lung
 | Human Lung |
| | Image 3 | Human Fetal Lung
 | Host: Rabbit
Target Name: EVX1
Sample Tissue: Human Fetal Lung
Antibody Dilution: 1.0ug/ml |
|
|
