Product Number |
P100820_P050 |
Product Page |
www.avivasysbio.com/tfdp1-antibody-n-terminal-region-p100820-p050.html |
Name |
TFDP1 Antibody - N-terminal region (P100820_P050) |
Protein Size (# AA) |
410 amino acids |
Molecular Weight |
45kDa |
NCBI Gene Id |
7027 |
Host |
Rabbit |
Clonality |
Polyclonal |
Concentration |
0.5 mg/ml |
Gene Full Name |
Transcription factor Dp-1 |
Description |
|
Alias Symbols |
DP1, DILC, Dp-1, DRTF1 |
Peptide Sequence |
Synthetic peptide located within the following region: VIGTPQRPAASNTLVVGSPHTPSTHFASQNQPSDSSPWSAGKRNRKGEKN |
Product Format |
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Reference |
Yasui,K., et al., (2003) J. Hum. Genet. 48 (12), 609-613 |
Description of Target |
The E2F transcription factor family regulates the expression of various cellular promoters, particularly those involved in the cell cycle. E2F factors bind to DNA as homodimers or heterodimers in association with dimerization partner DP1. TFDP1 may be the first example of a family of related transcription factors and may have a role in progression of some hepatocellular carcinomas by promoting growth of the tumor cells. |
Protein Interactions |
UBC; E2F6; E2F4; SIAH1; E2F3; E2F2; E2F1; CDK6; PRPF31; CDK2; CDK1; SOCS3; RB1; PCGF6; RYBP; YAF2; RNF2; ELAVL1; LIN9; LIN54; LIN37; RBL2; SERTAD2; NPDC1; E2F5; TP53; RBL1; CDK3; TP53BP1; |
Reconstitution and Storage |
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles. |
Datasheets/Manuals |
Printable datasheet for anti-TFDP1 (P100820_P050) antibody |
Blocking Peptide |
For anti-TFDP1 (P100820_P050) antibody is Catalog # AAP31168 (Previous Catalog # AAPP01911) |
Immunogen |
The immunogen is a synthetic peptide directed towards the N terminal region of human TFDP1 |
Uniprot ID |
Q14186 |
Protein Name |
Transcription factor Dp-1 |
Protein Accession # |
NP_009042 |
Purification |
Affinity Purified |
Nucleotide Accession # |
NM_007111 |
Tested Species Reactivity |
Human |
Gene Symbol |
TFDP1 |
Predicted Species Reactivity |
Human, Mouse, Cow |
Application |
IF, IHC, WB |
Predicted Homology Based on Immunogen Sequence |
Cow: 92%; Human: 100%; Mouse: 92% |
Image 1 | HCT116
| Sample Type: HCT116 Primary Antibody Dilution: 4 ug/ml Secondary Antibody: Anti-rabbit Alexa 546 Secondary Antibody Dilution: 2 ug/ml Gene Name: TFDP1 |
|
Image 2 | Human Liver
| WB Suggested Anti-TFDP1 Antibody Titration: 0.2-1 ug/ml Positive Control: Human Liver |
|
Image 3 | Human Intestine
| Human Intestine |
|