ATF7 Antibody - N-terminal region (P100817_P050)

Data Sheet
 
Product Number P100817_P050
Product Page www.avivasysbio.com/atf7-antibody-n-terminal-region-p100817-p050.html
Name ATF7 Antibody - N-terminal region (P100817_P050)
Protein Size (# AA) 483 amino acids
Molecular Weight 52kDa
NCBI Gene Id 11016
Host Rabbit
Clonality Polyclonal
Concentration 0.5 mg/ml
Gene Full Name Activating transcription factor 7
Description
Alias Symbols ATFA
Peptide Sequence Synthetic peptide located within the following region: ASSFEHEFKKAADEDEKKAAAGPLDMSLPSTPDIKIKEEEPVEVDSSPPD
Product Format Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Reference Olsen,J.V., (2006) Cell 127 (3), 635-648
Description of Target The human ATF7(ATFa) proteins belong to the ATF/CREB family of transcription factors.They mediate the transcriptional activation by the largest E1a protein and can heterodimerize with members of the Jun/Fos family. ATFa proteins have also been found tightly associated with JNK2, a stress-activated kinase. Four variants of ATFa (ATFa0, ATFa1, ATFa2, and ATFa3) have been characterized.
Protein Interactions FCER2; TMEM239; FAM9B; CCDC155; MITD1; OCIAD1; TAOK3; URI1; MAPK8; UBC; CREB1; Cebpb; SUMO2; YY1; BCL6; TAF12; TAF4; MAPK9; PTP4A1; PTP4A2; FOS; ATF2; JDP2;
Reconstitution and Storage For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Datasheets/Manuals Printable datasheet for anti-ATF7 (P100817_P050) antibody
Blocking Peptide For anti-ATF7 (P100817_P050) antibody is Catalog # AAP31164 (Previous Catalog # AAPP01907)
Immunogen The immunogen is a synthetic peptide directed towards the N terminal region of human ATF7
Uniprot ID B2RMP1
Protein Name Cyclic AMP-dependent transcription factor ATF-7
Protein Accession # NP_006847
Purification Affinity Purified
Nucleotide Accession # NM_006856
Tested Species Reactivity Human
Gene Symbol ATF7
Predicted Species Reactivity Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Pig, Rabbit
Application WB
Predicted Homology Based on Immunogen Sequence Cow: 100%; Dog: 92%; Guinea Pig: 92%; Horse: 84%; Human: 100%; Mouse: 78%; Pig: 100%; Rabbit: 100%; Rat: 84%
Image 1
Human Heart
WB Suggested Anti-ATF7 Antibody Titration: 0.2-1 ug/ml
ELISA Titer: 1:1562500
Positive Control: Human heart
 

AVIVA SYSTEMS BIOLOGY manufactures and sells quality antibody products covering genome wide proteins.

AVIVA SYSTEMS BIOLOGY
6370 Nancy Ridge Dr., Suite 104, San Diego, CA 92121 USA | Tel: (858)552-6979 | info@avivasysbio.com