NR2F2 Antibody - N-terminal region (P100816_P050)

Data Sheet
 
Product Number P100816_P050
Product Page www.avivasysbio.com/nr2f2-antibody-n-terminal-region-p100816-p050.html
Name NR2F2 Antibody - N-terminal region (P100816_P050)
Protein Size (# AA) 414 amino acids
Molecular Weight 45kDa
NCBI Gene Id 7026
Host Rabbit
Clonality Polyclonal
Concentration 0.5 mg/ml
Gene Full Name Nuclear receptor subfamily 2, group F, member 2
Description
Alias Symbols ARP1, ARP-1, CHTD4, NF-E3, SRXX5, SVP40, COUPTF2, COUPTFB, TFCOUP2, COUPTFII
Peptide Sequence Synthetic peptide located within the following region: KVGMRREAVQRGRMPPTQPTHGQFALTNGDPLNCHSYLSGYISLLLRAEP
Product Format Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Reference Sato,Y., (2003) J. Clin. Endocrinol. Metab. 88 (7), 3415-3420
Description of Target NR2F2, an orphan member of the nuclear hormone receptor superfamily, acts as a transcriptional repressor by antagonizing the functions of other nuclear hormone receptors and by actively silencing transcription. However, in certain contexts, NR2F2 stimulates transcription directly. NR2F2, MyoD and p300 interact in a competitive manner, and that increasing amounts of NR2F2 have the ability to reduce the interaction between myoD and p300 invitro. NR2F2 post-transcriptionally regulates myoD activity/function, and that crosstalk between orphan nuclear receptors and the myogenic bHLH proteins has functional consequences for differentiation.
Protein Interactions NSD1; BCL11A; NR2F2; BIK; SETD7; FAM46A; HIPK3; UBC; TFAP4; Cebpb; SMARCAD1; NR2F6; POU5F1; NR3C1; PHB2; TRIP4; PIAS1; BCL11B; TRIM24; EP300; SQSTM1; HDAC1; NCOR2; MYOD1; LCK;
Reconstitution and Storage For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Datasheets/Manuals Printable datasheet for anti-NR2F2 (P100816_P050) antibody
Blocking Peptide For anti-NR2F2 (P100816_P050) antibody is Catalog # AAP31163 (Previous Catalog # AAPS22105)
Immunogen The immunogen is a synthetic peptide directed towards the N terminal region of human NR2F2
Uniprot ID P24468
Protein Name COUP transcription factor 2
Publications

Déjardin, J. & Kingston, R. E. Purification of proteins associated with specific genomic Loci. Cell 136, 175-86 (2009). 19135898

Sample Type Confirmation

NR2F2 is supported by BioGPS gene expression data to be expressed in HEK293T

Protein Accession # NP_066285
Purification Affinity Purified
Nucleotide Accession # NM_021005
Tested Species Reactivity Human
Gene Symbol NR2F2
Predicted Species Reactivity Human, Mouse, Rat, Cow, Dog, Pig, Rabbit, Sheep, Zebrafish
Application IHC, WB
Predicted Homology Based on Immunogen Sequence Cow: 92%; Dog: 100%; Human: 100%; Mouse: 100%; Pig: 100%; Rabbit: 100%; Rat: 100%; Sheep: 92%; Zebrafish: 92%
Image 1
Human Lung
Rabbit Anti-NR2F2 Antibody
Catalog Number: P100816
Paraffin Embedded Tissue: Human alveolar cell
Cellular Data: Epithelial cells of renal tubule
Antibody Concentration: 4.0-8.0 ug/ml
Magnification: 400X
Image 2
293T, Human stomach
Host: Rabbit
Target: NR2F2
Positive control (+): 293T (2T)
Negative control (-): Human stomach (ST)
Antibody concentration: 1ug/ml
Image 3
Human Fetal Liver
Host: Rabbit
Target Name: NR2F2
Sample Tissue: Human Fetal Liver
Antibody Dilution: 1.0ug/ml
Image 4
Human Lung
Rabbit Anti-NR2F2 antibody
Catalog Number: P100816
Paraffin Embedded Tissue: Human Lung
cell Cellular Data: alveolar cell
Antibody Concentration: 4.0-8.0 ug/ml Magnification: 400X
 

AVIVA SYSTEMS BIOLOGY manufactures and sells quality antibody products covering genome wide proteins.

AVIVA SYSTEMS BIOLOGY
6370 Nancy Ridge Dr., Suite 104, San Diego, CA 92121 USA | Tel: (858)552-6979 | info@avivasysbio.com