TAF1A Antibody - C-terminal region (P100802_P050)

Data Sheet
 
Product Number P100802_P050
Product Page www.avivasysbio.com/taf1a-antibody-c-terminal-region-p100802-p050.html
Name TAF1A Antibody - C-terminal region (P100802_P050)
Protein Size (# AA) 336 amino acids
Molecular Weight 40kDa
Subunit A
NCBI Gene Id 9015
Host Rabbit
Clonality Polyclonal
Concentration 0.5 mg/ml
Gene Full Name TATA box binding protein (TBP)-associated factor, RNA polymerase I, A, 48kDa
Description
Alias Symbols SL1, RAFI48, TAFI48, MGC:17061
Peptide Sequence Synthetic peptide located within the following region: CEKAFVAGLLLGKGCRYFRYILKQDHQILGKKIKRMKRSVKKYSIVNPRL
Product Format Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Reference Di et al., (2000) Cytogenet. Cell Genet. 89 (1-2), 133-136
Description of Target Initiation of transcription by RNA polymerase I requires the formation of a complex composed of the TATA-binding protein (TBP) and three TBP-associated factors (TAFs) specific for RNA polymerase I. This complex, known as SL1, binds to the core promoter of ribosomal RNA genes to position the polymerase properly and acts as a channel for regulatory signals. TAF1A encodes the smallest SL1-specific TAF.
Protein Interactions C11orf57; JMJD6; TBP; Taf1c; Taf1b; BKRF1; UBC; TAF12; TAF1D; HIST1H4A; HIST1H3A; HIST2H2BE; HIST2H2AC; ESR1; SET; TAF1A; RUNX2; TP53; CD3EAP; HIST4H4; HIST3H3; ANP32A; UBTF; RRN3; MYC;
Reconstitution and Storage For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Datasheets/Manuals Printable datasheet for anti-TAF1A (P100802_P050) antibody
Blocking Peptide For anti-TAF1A (P100802_P050) antibody is Catalog # AAP31144 (Previous Catalog # AAPP01883)
Immunogen The immunogen is a synthetic peptide directed towards the C terminal region of human TAF1A
Uniprot ID Q9NWA1
Protein Name TATA box-binding protein-associated factor RNA polymerase I subunit A
Protein Accession # NP_647603
Nucleotide Accession # NM_139352
Tested Species Reactivity Human
Gene Symbol TAF1A
Predicted Species Reactivity Human, Mouse, Rat, Cow, Dog, Horse, Pig, Rabbit
Application IHC, WB
Predicted Homology Based on Immunogen Sequence Cow: 78%; Dog: 85%; Horse: 85%; Human: 100%; Mouse: 85%; Pig: 85%; Rabbit: 85%; Rat: 85%
Image 1
Human Heart
Human Heart
Image 2
Human Jurkat
WB Suggested Anti-TAF1A Antibody Titration: 0.2-1 ug/ml
Positive Control: Jurkat cell lysate
 

AVIVA SYSTEMS BIOLOGY manufactures and sells quality antibody products covering genome wide proteins.

AVIVA SYSTEMS BIOLOGY
6370 Nancy Ridge Dr., Suite 104, San Diego, CA 92121 USA | Tel: (858)552-6979 | info@avivasysbio.com