SOX9 Antibody - N-terminal region (P100797_T100)

Data Sheet
 
Product Number P100797_T100
Product Page https://www.avivasysbio.com/sox9-antibody-n-terminal-region-p100797-t100.html
Name SOX9 Antibody - N-terminal region (P100797_T100)
Protein Size (# AA) 509 amino acids
Molecular Weight 56 kDa
NCBI Gene Id 6662
Host Rabbit
Clonality Polyclonal
Concentration 1.0 mg/ml
Gene Full Name SRY (sex determining region Y)-box 9
Description
Alias Symbols CMD1, SRA1, CMPD1, SRXX2, SRXY10
Peptide Sequence Synthetic peptide located within the following region: PCPSGSGSDTENTRPQENTFPKGEPDLKKESEEDKFPVCIREAVSQVLKG
Product Format Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Reference Furumatsu,T., et al., (2005) J. Biol. Chem. 280 (42), 35203-35208
Description of Target SOX9 recognizes the sequence CCTTGAG along with other members of the HMG-box class DNA-binding proteins. It acts during chondrocyte differentiation and, with steroidogenic factor 1, regulates transcription of the anti-Muellerian hormone (AMH) gene. Deficiencies lead to the skeletal malformation syndrome campomelic dysplasia, frequently with sex reversal.
Protein Interactions ZBTB7A; SCX; HERC1; UBC; SOX9; ATP6V1H; ctnnb1-a; RUNX2; SMAD3; SMAD2; EP300; CREB3L4; SPEN; KPNB1; TRAF2; CREBBP; MED12; NR5A1; MAF; HSPA1A; CREB1;
Reconstitution and Storage For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Enhanced Validation
WBY
SPR
YCHAROS
Datasheets/Manuals Printable datasheet for anti-SOX9 (P100797_T100) antibody
Blocking Peptide For anti-SOX9 (P100797_T100) antibody is Catalog # AAP31138 (Previous Catalog # AAPP01877)
Immunogen The immunogen is a synthetic peptide directed towards the N terminal region of human SOX9
Uniprot ID P48436
Protein Name Transcription factor SOX-9
Publications

Ferrand, N. et al. Loss of WISP2/CCN5 in estrogen-dependent MCF7 human breast cancer cells promotes a stem-like cell phenotype. PLoS One 9, e87878 (2014). WB, Human, Mouse 24498388

Sample Type Confirmation

SOX9 is strongly supported by BioGPS gene expression data to be expressed in HepG2

Protein Accession # NP_000337
Purification Protein A purified
Nucleotide Accession # NM_000346
Tested Species Reactivity Human, Mouse
Gene Symbol SOX9
Predicted Species Reactivity Human, Mouse, Rat, Cow, Dog, Goat, Guinea Pig, Rabbit, Zebrafish
Application WB
Predicted Homology Based on Immunogen Sequence Cow: 100%; Dog: 100%; Goat: 100%; Guinea Pig: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%; Zebrafish: 92%
Image 1
Mouse Brain
Host: Rabbit
Target Name: SOX9
Sample Tissue: Mouse Brain
Antibody Dilution: 1ug/ml