SOX9 Antibody - N-terminal region (P100797_T100)

• Product Number: P100797_T100
• Name: SOX9 Antibody - N-terminal region (P100797_T100)
• Protein Size (# AA): 509 amino acids
• Molecular Weight: 56 kDa
• NCBI Gene Id: 6662
• Host: Rabbit
• Clonality: Polyclonal
• Concentration: 1.0 mg/ml
• Gene Full Name: SRY (sex determining region Y)-box 9
• Description:
  View product citations for SOX9 Antibody - N-terminal region (P100797_T100)on CiteAb
• Alias Symbols: CMD1, SRA1, CMPD1, SRXX2, SRXY10
• Peptide Sequence: Synthetic peptide located within the following region: PCPSGSGSDTENTRPQENTFPKGEPDLKKESEEDKFPVCIREAVSQVLKG
• Product Format: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Reference: Furumatsu,T., et al., (2005) J. Biol. Chem. 280 (42), 35203-35208
• Description of Target: SOX9 recognizes the sequence CCTTGAG along with other members of the HMG-box class DNA-binding proteins. It acts during chondrocyte differentiation and, with steroidogenic factor 1, regulates transcription of the anti-Muellerian hormone (AMH) gene. Deficiencies lead to the skeletal malformation syndrome campomelic dysplasia, frequently with sex reversal.
• Protein Interactions: ZBTB7A; SCX; HERC1; UBC; SOX9; ATP6V1H; ctnnb1-a; RUNX2; SMAD3; SMAD2; EP300; CREB3L4; SPEN; KPNB1; TRAF2; CREBBP; MED12; NR5A1; MAF; HSPA1A; CREB1;
• Reconstitution and Storage: For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
• Enhanced Validation:

  WB	Y
  SPR
  YCHAROS

• Blocking Peptide: For anti-SOX9 (P100797_T100) antibody is Catalog # AAP31138 (Previous Catalog # AAPP01877)
• Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human SOX9
• Uniprot ID: P48436
• Protein Name: Transcription factor SOX-9
• Publications:

  Ferrand, N. et al. Loss of WISP2/CCN5 in estrogen-dependent MCF7 human breast cancer cells promotes a stem-like cell phenotype. PLoS One 9, e87878 (2014). WB, Human, Mouse 24498388

• Sample Type Confirmation:

  SOX9 is strongly supported by BioGPS gene expression data to be expressed in HepG2

• Protein Accession #: NP_000337
• Purification: Protein A purified
• Nucleotide Accession #: NM_000346
• Tested Species Reactivity: Human, Mouse
• Gene Symbol: SOX9
• Predicted Species Reactivity: Human, Mouse, Rat, Cow, Dog, Goat, Guinea Pig, Rabbit, Zebrafish
• Application: WB
• Predicted Homology Based on Immunogen Sequence: Cow: 100%; Dog: 100%; Goat: 100%; Guinea Pig: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%; Zebrafish: 92%
• Image 1: Mouse Brain
  
  Host: Rabbit
  Target Name: SOX9
  Sample Tissue: Mouse Brain
  Antibody Dilution: 1ug/ml