TCF4 Antibody - N-terminal region (P100775_P050)

Data Sheet
 
Product Number P100775_P050
Product Page www.avivasysbio.com/tcf4-antibody-n-terminal-region-p100775-p050.html
Name TCF4 Antibody - N-terminal region (P100775_P050)
Protein Size (# AA) 667 amino acids
Molecular Weight 71kDa
NCBI Gene Id 6925
Host Rabbit
Clonality Polyclonal
Concentration 0.5 mg/ml
Gene Full Name Transcription factor 4
Description
Alias Symbols E2-2, ITF2, PTHS, SEF2, CDG2T, FECD3, ITF-2, SEF-2, TCF-4, SEF2-1, SEF2-1A, SEF2-1B, SEF2-1D, bHLHb19
Peptide Sequence Synthetic peptide located within the following region: MHHQQRMAALGTDKELSDLLDFSAMFSPPVSSGKNGPTSLASGHFTGSNV
Product Format Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Reference Lu,Y., (2005) Biochem Biophys Res Commun. 336(1), 142-9
Description of Target TCF4 encodes transcription factor 4, a basic helix-turn-helix transcription factor. The protein recognizes an Ephrussi-box ('E-box') binding site ('CANNTG') - a motif first identified in immunoglobulin enhancers. TCF4 is expressed predominantly in pre-B-cells, although it is found in other tissues as well.
Protein Interactions GOLGA8F; REXO1L6P; FAM74A4; GOLGA8EP; C9orf171; RAB41; SEC14L4; NEK8; ZDHHC24; MSRB3; FERD3L; PPP1R18; NUDT10; PATE1; TMEM213; KLC3; ZNF417; NEU4; NR2C2AP; POLR1A; SZT2; EPB41L3; MAPKBP1; SLC4A1AP; FRS3; NEK6; GLRX3; MAD2L2; BCAS2; TSSC4; CHAF1A; POLR1C;
Reconstitution and Storage For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Datasheets/Manuals Printable datasheet for anti-TCF4 (P100775_P050) antibody
Blocking Peptide For anti-TCF4 (P100775_P050) antibody is Catalog # AAP31105 (Previous Catalog # AAPP01844)
Immunogen The immunogen is a synthetic peptide directed towards the N terminal region of human TCF4
Uniprot ID P15884
Protein Name Transcription factor 4
Protein Accession # NP_003190
Purification Affinity Purified
Nucleotide Accession # NM_003199
Tested Species Reactivity Human
Gene Symbol TCF4
Predicted Species Reactivity Human, Mouse, Guinea Pig, Horse
Application WB
Predicted Homology Based on Immunogen Sequence Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%
Image 1
Human Placenta
WB Suggested Anti-TCF4 Antibody Titration: 0.2-1 ug/ml
Positive Control: Human Placenta
Image 2
Human HT1080
Host: Rabbit
Target Name: TCF4
Sample Type: HT1080 Whole Cell lysates
Antibody Dilution: 1.0ug/ml
 

AVIVA SYSTEMS BIOLOGY manufactures and sells quality antibody products covering genome wide proteins.

AVIVA SYSTEMS BIOLOGY
10211 Pacific Mesa Blvd, Ste 401, San Diego, CA 92121 USA | Tel: (858)552-6979 | info@avivasysbio.com