TCF12 Antibody - middle region (P100772_P050)

Data Sheet
 
Product Number P100772_P050
Product Page www.avivasysbio.com/tcf12-antibody-middle-region-p100772-p050.html
Name TCF12 Antibody - middle region (P100772_P050)
Protein Size (# AA) 682 amino acids
Molecular Weight 73kDa
NCBI Gene Id 6938
Host Rabbit
Clonality Polyclonal
Concentration 0.5 mg/ml
Gene Full Name Transcription factor 12
Description
Alias Symbols HEB, p64, CRS3, HTF4, TCF-12, bHLHb20, HsT17266
Peptide Sequence Synthetic peptide located within the following region: GGLQSQSGTVVTTEIKTENKEKDENLHEPPSSDDMKSDDESSQKDIKVSS
Product Format Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Reference Wissmuller,S., (2006) (er) Nucleic Acids Res. 34 (6), 1735-1744
Description of Target TCF12 encodes a protein that is a member of the basic helix-loop-helix (bHLH) E-protein family which recognizes the consensus binding site (E-box) CANNTG. This encoded protein is expressed in many tissues, among them skeletal muscle, thymus, B- and T-cell. The protein encoded by this gene is a member of the basic helix-loop-helix (bHLH) E-protein family that recognizes the consensus binding site (E-box) CANNTG. This encoded protein is expressed in many tissues, among them skeletal muscle, thymus, B- and T-cells, and may participate in regulating lineage-specific gene expression through the formation of heterodimers with other bHLH E-proteins. Several alternatively spliced transcript variants of this gene have been described, but the full-length nature of some of these variants has not been determined.
Protein Interactions TSNAX; STAT5A; SRI; RNASEL; QARS; PSMA1; MLLT6; ID3; CDKN2C; TRIM72; LYSMD1; C6orf165; HEXIM2; ASCL4; MORN4; TWIST2; C16orf45; HOPX; NAGK; C1orf109; SPG21; VPS28; NEUROG3; OSGIN1; CRCP; EDRF1; ARMC8; MAPKBP1; STK16; DGCR6; UBC; TCF21; SOX2; ID2; BMF; MYC;
Reconstitution and Storage For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Datasheets/Manuals Printable datasheet for anti-TCF12 (P100772_P050) antibody
Blocking Peptide For anti-TCF12 (P100772_P050) antibody is Catalog # AAP31100 (Previous Catalog # AAPP01839)
Immunogen The immunogen is a synthetic peptide directed towards the middle region of human TCF12
Uniprot ID Q99081
Protein Name Transcription factor 12
Protein Accession # NP_003196
Purification Affinity Purified
Nucleotide Accession # NM_003205
Tested Species Reactivity Human
Gene Symbol TCF12
Predicted Species Reactivity Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse
Application WB
Predicted Homology Based on Immunogen Sequence Cow: 100%; Dog: 100%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rat: 100%
Image 1
Human HeLa
WB Suggested Anti-TCF12 Antibody Titration: 0.2-1 ug/ml
ELISA Titer: 1:312500
Positive Control: Hela cell lysate
 

AVIVA SYSTEMS BIOLOGY manufactures and sells quality antibody products covering genome wide proteins.

AVIVA SYSTEMS BIOLOGY
6370 Nancy Ridge Dr., Suite 104, San Diego, CA 92121 USA | Tel: (858)552-6979 | info@avivasysbio.com