TCF12 Antibody - N-terminal region (P100771_P050)

Data Sheet
 
Product Number P100771_P050
Product Page www.avivasysbio.com/tcf12-antibody-n-terminal-region-p100771-p050.html
Name TCF12 Antibody - N-terminal region (P100771_P050)
Protein Size (# AA) 706 amino acids
Molecular Weight 73kDa
NCBI Gene Id 6938
Host Rabbit
Clonality Polyclonal
Concentration 0.5 mg/ml
Gene Full Name Transcription factor 12
Description
Alias Symbols HEB, p64, CRS3, HTF4, TCF-12, bHLHb20, HsT17266
Peptide Sequence Synthetic peptide located within the following region: QQQRMAAIGTDKELSDLLDFSAMFSPPVNSGKTRPTTLGSSQFSGSGIDE
Product Format Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Reference Zhang,J., et al., (2004) Science 305 (5688), 1286-1289
Description of Target TCF12 encodes a protein that is a member of the basic helix-loop-helix (bHLH) E-protein family which recognizes the consensus binding site (E-box) CANNTG. This encoded protein is expressed in many tissues, among them skeletal muscle, thymus, B- and T-cells, and may participate in regulating lineage-specific gene expression through the formation of heterodimers with other bHLH E-proteins.The protein encoded by this gene is a member of the basic helix-loop-helix (bHLH) E-protein family that recognizes the consensus binding site (E-box) CANNTG. This encoded protein is expressed in many tissues, among them skeletal muscle, thymus, B- and T-cells, and may participate in regulating lineage-specific gene expression through the formation of heterodimers with other bHLH E-proteins. Several alternatively spliced transcript variants of this gene have been described, but the full-length nature of some of these variants has not been determined.
Protein Interactions TSNAX; STAT5A; SRI; RNASEL; QARS; PSMA1; MLLT6; ID3; CDKN2C; TRIM72; LYSMD1; C6orf165; HEXIM2; ASCL4; MORN4; TWIST2; C16orf45; HOPX; NAGK; C1orf109; SPG21; VPS28; NEUROG3; OSGIN1; CRCP; EDRF1; ARMC8; MAPKBP1; STK16; DGCR6; UBC; TCF21; SOX2; ID2; BMF; MYC;
Reconstitution and Storage For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Datasheets/Manuals Printable datasheet for anti-TCF12 (P100771_P050) antibody
Blocking Peptide For anti-TCF12 (P100771_P050) antibody is Catalog # AAP31099 (Previous Catalog # AAPS32601)
Immunogen The immunogen is a synthetic peptide directed towards the N terminal region of human TCF12
Uniprot ID Q99081
Protein Name Transcription factor 12
Protein Accession # NP_996919
Purification Affinity Purified
Nucleotide Accession # NM_207036
Tested Species Reactivity Human, Mouse
Gene Symbol TCF12
Predicted Species Reactivity Human, Mouse, Cow, Pig, Zebrafish
Application WB
Predicted Homology Based on Immunogen Sequence Cow: 100%; Human: 100%; Mouse: 100%; Pig: 100%; Zebrafish: 92%
Image 1
Human Lung
WB Suggested Anti-TCF12 Antibody Titration: 0.06ug/ml
ELISA Titer: 1:1562500
Positive Control: Human Lung
Image 2
Human Fetal Brain
Host: Rabbit
Target Name: TCF12
Sample Type: Human Fetal Brain
Antibody Dilution: 1.0ug/ml
Image 3
Mouse Skeletal Muscle
Host: Mouse
Target Name: TCF12
Sample Tissue: Mouse Skeletal Muscle
Antibody Dilution: 1ug/ml
 

AVIVA SYSTEMS BIOLOGY manufactures and sells quality antibody products covering genome wide proteins.

AVIVA SYSTEMS BIOLOGY
10211 Pacific Mesa Blvd, Ste 401, San Diego, CA 92121 USA | Tel: (858)552-6979 | info@avivasysbio.com