CREB5 Antibody - N-terminal region (P100755_T100)

Data Sheet
 
Product Number P100755_T100
Product Page www.avivasysbio.com/creb5-antibody-n-terminal-region-p100755-t100.html
Name CREB5 Antibody - N-terminal region (P100755_T100)
Protein Size (# AA) 475 amino acids
Molecular Weight 53kDa
NCBI Gene Id 9586
Host Rabbit
Clonality Polyclonal
Concentration 1.0 mg/ml
Gene Full Name CAMP responsive element binding protein 5
Description
Alias Symbols CREB-5, CREBPA, CRE-BPA
Peptide Sequence Synthetic peptide located within the following region: CSLEHEFRKAQEEESSKRNISMHNAVGGAMTGPGTHQLSSARLPNHDTNV
Product Format Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Reference Zu,Y.L., et al., (1993) Oncogene 8 (10), 2749-2758
Description of Target CREB5 belongs to the CRE (cAMP response element)-binding protein family. Members of this family contain zinc-finger and bZIP DNA-binding domains. This protein specifically binds to CRE as a homodimer or a heterodimer with c-Jun or CRE-BP1, and functions as a CRE-dependent trans-activator. Alternatively spliced transcript variants encoding different isoforms have been identified.
Protein Interactions KRTAP10-5; KRTAP10-11; KRTAP10-1; KRTAP10-9; KRTAP10-7; MGAT5B; KRT40; RIMBP3; KRTAP4-2; KRTAP9-4; KRTAP9-2; KRTAP3-2; KRTAP4-12; TSGA10; ADAMTSL4; EFEMP2; MTUS2; RBPMS; SPRY2; SPRY1; RGS20; FOSL1; TRIP6; TRAF2; MDFI; KRT15; KIFC3; FOSL2; FOS; COL8A1; TRI
Reconstitution and Storage For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Datasheets/Manuals Printable datasheet for anti-CREB5 (P100755_T100) antibody
Blocking Peptide For anti-CREB5 (P100755_T100) antibody is Catalog # AAP31076 (Previous Catalog # AAPP01815)
Immunogen The immunogen is a synthetic peptide directed towards the N terminal region of human CREB5
Uniprot ID Q02930
Protein Name Cyclic AMP-responsive element-binding protein 5
Protein Accession # NP_878902
Purification Protein A purified
Nucleotide Accession # NM_182899
Tested Species Reactivity Human
Gene Symbol CREB5
Predicted Species Reactivity Human, Mouse, Rat, Dog, Guinea Pig, Horse, Pig, Rabbit
Application WB
Predicted Homology Based on Immunogen Sequence Dog: 100%; Guinea Pig: 85%; Horse: 100%; Human: 100%; Mouse: 92%; Pig: 100%; Rabbit: 100%; Rat: 100%
Image 1
Human HepG2
WB Suggested Anti-CREB5 Antibody Titration: 1.25ug/ml
Positive Control: HepG2 cell lysate
 

AVIVA SYSTEMS BIOLOGY manufactures and sells quality antibody products covering genome wide proteins.

AVIVA SYSTEMS BIOLOGY
6370 Nancy Ridge Dr., Suite 104, San Diego, CA 92121 USA | Tel: (858)552-6979 | info@avivasysbio.com