Product Number |
P100701_P050 |
Product Page |
www.avivasysbio.com/ercc2-antibody-n-terminal-region-p100701-p050.html |
Name |
ERCC2 Antibody - N-terminal region (P100701_P050) |
Protein Size (# AA) |
760 amino acids |
Molecular Weight |
87kDa |
NCBI Gene Id |
2068 |
Host |
Rabbit |
Clonality |
Polyclonal |
Concentration |
0.5 mg/ml |
Gene Full Name |
Excision repair cross-complementing rodent repair deficiency, complementation group 2 |
Description |
|
Alias Symbols |
EM9, TTD, XPD, TTD1, COFS2, TFIIH |
Peptide Sequence |
Synthetic peptide located within the following region: KLNVDGLLVYFPYDYIYPEQFSYMRELKRTLDAKGHGVLEMPSGTGKTVS |
Product Format |
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Reference |
Braun,M.S., (2008) J. Clin. Oncol. 26 (16), 2690-2698 |
Description of Target |
The nucleotide excision repair pathway is a mechanism to repair damage to DNA. ERCC2 is involved in transcription-coupled nucleotide excision repair and is an integral member of the basal transcription factor BTF2/TFIIH complex. This protein has ATP-dependent DNA helicase activity and belongs to the RAD3/XPD subfamily of helicases. Defects in this gene can result in three different disorders, the cancer-prone syndrome xeroderma pigmentosum complementation group D, trichothiodystrophy, and Cockayne syndrome. Alternatively spliced transcript variants encoding different isoforms have been found for this gene. The nucleotide excision repair pathway is a mechanism to repair damage to DNA. The protein encoded by this gene is involved in transcription-coupled nucleotide excision repair and is an integral member of the basal transcription factor BTF2/TFIIH complex. The gene product has ATP-dependent DNA helicase activity and belongs to the RAD3/XPD subfamily of helicases. Defects in this gene can result in three different disorders, the cancer-prone syndrome xeroderma pigmentosum complementation group D, trichothiodystrophy, and Cockayne syndrome. Publication Note: This RefSeq record includes a subset of the publications that are available for this gene. Please see the Entrez Gene record to access additional publications. |
Protein Interactions |
GTF2H2C_2; UBC; FAM96B; CIAO1; rev; CDK7; TP53; MMS19; ERCC3; UVSSA; RAD52; GTF2H1; MNAT1; CCNH; GTF2F1; PIDD1; GTF2H3; GTF2H2; AR; ERCC6; tat; ATF7IP; HERC5; ISG15; TRIM25; RAD51; ERCC5; ERCC2; CDK1; |
Reconstitution and Storage |
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles. |
Datasheets/Manuals |
Printable datasheet for anti-ERCC2 (P100701_P050) antibody |
Blocking Peptide |
For anti-ERCC2 (P100701_P050) antibody is Catalog # AAP31053 (Previous Catalog # AAPP01787) |
Immunogen |
The immunogen is a synthetic peptide directed towards the N terminal region of human ERCC2 |
Uniprot ID |
P18074 |
Protein Name |
TFIIH basal transcription factor complex helicase XPD subunit |
Protein Accession # |
NP_000391 |
Purification |
Affinity Purified |
Nucleotide Accession # |
NM_000400 |
Tested Species Reactivity |
Human |
Gene Symbol |
ERCC2 |
Predicted Species Reactivity |
Human, Mouse, Rat, Cow, Guinea Pig, Zebrafish |
Application |
WB |
Predicted Homology Based on Immunogen Sequence |
Cow: 100%; Guinea Pig: 100%; Human: 100%; Mouse: 100%; Rat: 100%; Zebrafish: 100% |
Image 1 | Human Muscle
| WB Suggested Anti-ERCC2 Antibody Titration: 0.2-1 ug/ml ELISA Titer: 1:312500 Positive Control: Human Muscle |
|