ERCC2 Antibody - N-terminal region (P100701_P050)

Data Sheet
 
Product Number P100701_P050
Product Page www.avivasysbio.com/ercc2-antibody-n-terminal-region-p100701-p050.html
Name ERCC2 Antibody - N-terminal region (P100701_P050)
Protein Size (# AA) 760 amino acids
Molecular Weight 87kDa
NCBI Gene Id 2068
Host Rabbit
Clonality Polyclonal
Concentration 0.5 mg/ml
Gene Full Name Excision repair cross-complementing rodent repair deficiency, complementation group 2
Description
Alias Symbols EM9, TTD, XPD, TTD1, COFS2, TFIIH
Peptide Sequence Synthetic peptide located within the following region: KLNVDGLLVYFPYDYIYPEQFSYMRELKRTLDAKGHGVLEMPSGTGKTVS
Product Format Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Reference Braun,M.S., (2008) J. Clin. Oncol. 26 (16), 2690-2698
Description of Target The nucleotide excision repair pathway is a mechanism to repair damage to DNA. ERCC2 is involved in transcription-coupled nucleotide excision repair and is an integral member of the basal transcription factor BTF2/TFIIH complex. This protein has ATP-dependent DNA helicase activity and belongs to the RAD3/XPD subfamily of helicases. Defects in this gene can result in three different disorders, the cancer-prone syndrome xeroderma pigmentosum complementation group D, trichothiodystrophy, and Cockayne syndrome. Alternatively spliced transcript variants encoding different isoforms have been found for this gene. The nucleotide excision repair pathway is a mechanism to repair damage to DNA. The protein encoded by this gene is involved in transcription-coupled nucleotide excision repair and is an integral member of the basal transcription factor BTF2/TFIIH complex. The gene product has ATP-dependent DNA helicase activity and belongs to the RAD3/XPD subfamily of helicases. Defects in this gene can result in three different disorders, the cancer-prone syndrome xeroderma pigmentosum complementation group D, trichothiodystrophy, and Cockayne syndrome. Publication Note: This RefSeq record includes a subset of the publications that are available for this gene. Please see the Entrez Gene record to access additional publications.
Protein Interactions GTF2H2C_2; UBC; FAM96B; CIAO1; rev; CDK7; TP53; MMS19; ERCC3; UVSSA; RAD52; GTF2H1; MNAT1; CCNH; GTF2F1; PIDD1; GTF2H3; GTF2H2; AR; ERCC6; tat; ATF7IP; HERC5; ISG15; TRIM25; RAD51; ERCC5; ERCC2; CDK1;
Reconstitution and Storage For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Datasheets/Manuals Printable datasheet for anti-ERCC2 (P100701_P050) antibody
Blocking Peptide For anti-ERCC2 (P100701_P050) antibody is Catalog # AAP31053 (Previous Catalog # AAPP01787)
Immunogen The immunogen is a synthetic peptide directed towards the N terminal region of human ERCC2
Uniprot ID P18074
Protein Name TFIIH basal transcription factor complex helicase XPD subunit
Protein Accession # NP_000391
Purification Affinity Purified
Nucleotide Accession # NM_000400
Tested Species Reactivity Human
Gene Symbol ERCC2
Predicted Species Reactivity Human, Mouse, Rat, Cow, Guinea Pig, Zebrafish
Application WB
Predicted Homology Based on Immunogen Sequence Cow: 100%; Guinea Pig: 100%; Human: 100%; Mouse: 100%; Rat: 100%; Zebrafish: 100%
Image 1
Human Muscle
WB Suggested Anti-ERCC2 Antibody Titration: 0.2-1 ug/ml
ELISA Titer: 1:312500
Positive Control: Human Muscle
 

AVIVA SYSTEMS BIOLOGY manufactures and sells quality antibody products covering genome wide proteins.

AVIVA SYSTEMS BIOLOGY
10211 Pacific Mesa Blvd, Ste 401, San Diego, CA 92121 USA | Tel: (858)552-6979 | info@avivasysbio.com