RFX1 Antibody - C-terminal region (P100690_P050)

Data Sheet
 
Product Number P100690_P050
Product Page www.avivasysbio.com/rfx1-antibody-c-terminal-region-p100690-p050.html
Name RFX1 Antibody - C-terminal region (P100690_P050)
Protein Size (# AA) 979 amino acids
Molecular Weight 105kDa
NCBI Gene Id 5989
Host Rabbit
Clonality Polyclonal
Concentration 0.5 mg/ml
Gene Full Name Regulatory factor X, 1 (influences HLA class II expression)
Description
Alias Symbols EFC, RFX
Peptide Sequence Synthetic peptide located within the following region: ESEDELPQDISLAAGGESPALGPETLEPPAKLARTDARGLFVQALPSS
Product Format Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Reference Wang,K.R., (2007) J. Biol. Chem. 282 (36), 26167-26177
Description of Target RFX1 is a member of the regulatory factor X protein family, which are transcription factors that contain a highly-conserved winged helix DNA binding domain. RFX1 is structurally related to regulatory factors X2, X3, X4, and X5. It is a transcriptional activator that can bind DNA as a monomer or as a heterodimer with RFX family members X2, X3, and X5, but not with X4. This protein binds to the X-boxes of MHC class II genes and is essential for their expression. Also, it can bind to an inverted repeat that is required for expression of hepatitis B virus genes.This gene is a member of the regulatory factor X gene family, which encodes transcription factors that contain a highly-conserved winged helix DNA binding domain. The protein encoded by this gene is structurally related to regulatory factors X2, X3, X4, and X5. It is a transcriptional activator that can bind DNA as a monomer or as a heterodimer with RFX family members X2, X3, and X5, but not with X4. This protein binds to the X-boxes of MHC class II genes and is essential for their expression. Also, it can bind to an inverted repeat that is required for expression of hepatitis B virus genes. Publication Note: This RefSeq record includes a subset of the publications that are available for this gene. Please see the Entrez Gene record to access additional publications.
Protein Interactions SOX2; SMAD9; SMAD4; SMAD1; NOTCH1; Cebpb; NCOA3; HDAC1; NFIC; NFIB; TADA3; RFX3; MAGED1; ABL1; NFIX; HMGB1; HIVEP2; RFX2; ADD1;
Reconstitution and Storage For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Datasheets/Manuals Printable datasheet for anti-RFX1 (P100690_P050) antibody
Blocking Peptide For anti-RFX1 (P100690_P050) antibody is Catalog # AAP31034 (Previous Catalog # AAPP01767)
Immunogen The immunogen is a synthetic peptide directed towards the C terminal region of human RFX1
Uniprot ID P22670
Protein Name MHC class II regulatory factor RFX1
Protein Accession # NP_002909
Purification Affinity Purified
Nucleotide Accession # NM_002918
Tested Species Reactivity Human, Mouse
Gene Symbol RFX1
Predicted Species Reactivity Human, Mouse, Rat, Cow, Dog, Guinea Pig, Pig, Zebrafish
Application WB
Predicted Homology Based on Immunogen Sequence Cow: 100%; Dog: 100%; Guinea Pig: 100%; Human: 100%; Mouse: 92%; Pig: 92%; Rat: 92%; Zebrafish: 92%
Image 1
Human MCF-7
WB Suggested Anti-RFX1 Antibody Titration: 0.2-1 ug/ml
ELISA Titer: 1:312500
Positive Control: MCF7 cell lysate
Image 2
Mouse Pancreas
Host: Mouse
Target Name: RFX1
Sample Tissue: Mouse Pancreas
Antibody Dilution: 1ug/ml
 

AVIVA SYSTEMS BIOLOGY manufactures and sells quality antibody products covering genome wide proteins.

AVIVA SYSTEMS BIOLOGY
10211 Pacific Mesa Blvd, Ste 401, San Diego, CA 92121 USA | Tel: (858)552-6979 | info@avivasysbio.com