Product Number |
P100690_P050 |
Product Page |
www.avivasysbio.com/rfx1-antibody-c-terminal-region-p100690-p050.html |
Name |
RFX1 Antibody - C-terminal region (P100690_P050) |
Protein Size (# AA) |
979 amino acids |
Molecular Weight |
105kDa |
NCBI Gene Id |
5989 |
Host |
Rabbit |
Clonality |
Polyclonal |
Concentration |
0.5 mg/ml |
Gene Full Name |
Regulatory factor X, 1 (influences HLA class II expression) |
Description |
|
Alias Symbols |
EFC, RFX |
Peptide Sequence |
Synthetic peptide located within the following region: ESEDELPQDISLAAGGESPALGPETLEPPAKLARTDARGLFVQALPSS |
Product Format |
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Reference |
Wang,K.R., (2007) J. Biol. Chem. 282 (36), 26167-26177 |
Description of Target |
RFX1 is a member of the regulatory factor X protein family, which are transcription factors that contain a highly-conserved winged helix DNA binding domain. RFX1 is structurally related to regulatory factors X2, X3, X4, and X5. It is a transcriptional activator that can bind DNA as a monomer or as a heterodimer with RFX family members X2, X3, and X5, but not with X4. This protein binds to the X-boxes of MHC class II genes and is essential for their expression. Also, it can bind to an inverted repeat that is required for expression of hepatitis B virus genes.This gene is a member of the regulatory factor X gene family, which encodes transcription factors that contain a highly-conserved winged helix DNA binding domain. The protein encoded by this gene is structurally related to regulatory factors X2, X3, X4, and X5. It is a transcriptional activator that can bind DNA as a monomer or as a heterodimer with RFX family members X2, X3, and X5, but not with X4. This protein binds to the X-boxes of MHC class II genes and is essential for their expression. Also, it can bind to an inverted repeat that is required for expression of hepatitis B virus genes. Publication Note: This RefSeq record includes a subset of the publications that are available for this gene. Please see the Entrez Gene record to access additional publications. |
Protein Interactions |
SOX2; SMAD9; SMAD4; SMAD1; NOTCH1; Cebpb; NCOA3; HDAC1; NFIC; NFIB; TADA3; RFX3; MAGED1; ABL1; NFIX; HMGB1; HIVEP2; RFX2; ADD1; |
Reconstitution and Storage |
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles. |
Datasheets/Manuals |
Printable datasheet for anti-RFX1 (P100690_P050) antibody |
Blocking Peptide |
For anti-RFX1 (P100690_P050) antibody is Catalog # AAP31034 (Previous Catalog # AAPP01767) |
Immunogen |
The immunogen is a synthetic peptide directed towards the C terminal region of human RFX1 |
Uniprot ID |
P22670 |
Protein Name |
MHC class II regulatory factor RFX1 |
Protein Accession # |
NP_002909 |
Purification |
Affinity Purified |
Nucleotide Accession # |
NM_002918 |
Tested Species Reactivity |
Human, Mouse |
Gene Symbol |
RFX1 |
Predicted Species Reactivity |
Human, Mouse, Rat, Cow, Dog, Guinea Pig, Pig, Zebrafish |
Application |
WB |
Predicted Homology Based on Immunogen Sequence |
Cow: 100%; Dog: 100%; Guinea Pig: 100%; Human: 100%; Mouse: 92%; Pig: 92%; Rat: 92%; Zebrafish: 92% |
Image 1 | Human MCF-7
| WB Suggested Anti-RFX1 Antibody Titration: 0.2-1 ug/ml ELISA Titer: 1:312500 Positive Control: MCF7 cell lysate |
|
Image 2 | Mouse Pancreas
| Host: Mouse Target Name: RFX1 Sample Tissue: Mouse Pancreas Antibody Dilution: 1ug/ml |
|