Product Number |
P100612_P050 |
Product Page |
www.avivasysbio.com/tlx1-antibody-middle-region-p100612-p050.html |
Name |
TLX1 Antibody - middle region (P100612_P050) |
Protein Size (# AA) |
330 amino acids |
Molecular Weight |
34kDa |
NCBI Gene Id |
3195 |
Host |
Rabbit |
Clonality |
Polyclonal |
Concentration |
0.5 mg/ml |
Gene Full Name |
T-cell leukemia homeobox 1 |
Alias Symbols |
TCL3, HOX11 |
Peptide Sequence |
Synthetic peptide located within the following region: EAFQKSLAQPLPADPLCVHNSSLFALQNLQPWSDDSTKITSVTSVASACE |
Product Format |
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Reference |
Baak,U., (2008) Leukemia 22 (6), 1154-1160 |
Description of Target |
TLX1 contains 1 homeobox DNA-binding domain. TLX1 controls the genesis of the spleen. A chromosomal aberration involving TLX1, translocation t(10;14)(q24;q11) with TCRD, may be a cause of a form of T-cell acute lymphoblastic leukemia (T-ALL). |
Protein Interactions |
TLE1; PPP1CC; PPP1CB; NFIC; PPP2CA; PKNOX1; MEIS1; TLX1; PPP2CB; |
Reconstitution and Storage |
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles. |
Datasheets/Manuals |
Printable datasheet for anti-TLX1 (P100612_P050) antibody |
Blocking Peptide |
For anti-TLX1 (P100612_P050) antibody is Catalog # AAP30922 (Previous Catalog # AAPP01646) |
Immunogen |
The immunogen is a synthetic peptide directed towards the middle region of human TLX1 |
Uniprot ID |
P31314 |
Protein Name |
T-cell leukemia homeobox protein 1 |
Protein Accession # |
NP_005512 |
Purification |
Affinity Purified |
Nucleotide Accession # |
NM_005521 |
Tested Species Reactivity |
Human |
Gene Symbol |
TLX1 |
Predicted Species Reactivity |
Human, Mouse, Rat, Cow, Dog, Guinea Pig, Rabbit |
Application |
WB |
Predicted Homology Based on Immunogen Sequence |
Cow: 100%; Dog: 100%; Guinea Pig: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100% |
Image 1 | Human Heart
 | WB Suggested Anti-TLX1 Antibody Titration: 0.2-1 ug/ml ELISA Titer: 1:312500 Positive Control: Human heart |
|
|