DEK Antibody - middle region (P100602_P050)

Data Sheet
 
Product Number P100602_P050
Product Page www.avivasysbio.com/dek-antibody-middle-region-p100602-p050.html
Name DEK Antibody - middle region (P100602_P050)
Protein Size (# AA) 375 amino acids
Molecular Weight 43kDa
NCBI Gene Id 7913
Host Rabbit
Clonality Polyclonal
Concentration 0.5 mg/ml
Gene Full Name DEK oncogene
Description
Alias Symbols D6S231E
Peptide Sequence Synthetic peptide located within the following region: ELKETIKKLLASANLEEVTMKQICKKVYENYPTYDLTERKDFIKTTVKEL
Product Format Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Reference Wu,Q., (2008) Pathol. Int. 58 (6), 378-382
Description of Target DEK is a protein with one SAP domain. This protein binds to cruciform and superhelical DNA and induces positive supercoils into closed circular DNA, and is also involved in splice site selection during mRNA processing. Chromosomal aberrations involving this region, increased expression of this gene, and the presence of antibodies against this protein are all associated with various diseases. Two transcript variants encoding different isoforms have been found for this gene.This gene encodes a protein with one SAP domain. This protein binds to cruciform and superhelical DNA and induces positive supercoils into closed circular DNA and is also involved in splice site selection during mRNA processing. Chromosomal aberrations involving this region, increased expression of this gene and the presence of antibodies against this protein are all associated with various diseases. Publication Note: This RefSeq record includes a subset of the publications that are available for this gene. Please see the Entrez Gene record to access additional publications.
Protein Interactions CUL3; SPOP; UBC; EED; IRF2BP2; GANAB; PTPN12; CSNK2A2; CSNK2A1; TP53BP1; ESR1; VTN; S100A9; RPL37A; DHX15; FTSJ3; WIBG; TMED9; EXOSC2; UTP14A; THRAP3; CAND1; COPS5; CDK2; YWHAZ; Cebpb; ELAVL1; SUMO1; SUMO2; RAD21; HDGF; KAT2B; EP300; CREBBP; HIST1H4A; HDA
Reconstitution and Storage For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Datasheets/Manuals Printable datasheet for anti-DEK (P100602_P050) antibody
Blocking Peptide For anti-DEK (P100602_P050) antibody is Catalog # AAP30906 (Previous Catalog # AAPP01630)
Immunogen The immunogen is a synthetic peptide directed towards the middle region of human DEK
Uniprot ID P35659
Protein Name Protein DEK
Protein Accession # NP_003463
Purification Affinity Purified
Nucleotide Accession # NM_003472
Tested Species Reactivity Human
Gene Symbol DEK
Predicted Species Reactivity Human, Mouse, Rat, Cow, Guinea Pig, Horse, Pig, Rabbit
Application WB
Predicted Homology Based on Immunogen Sequence Cow: 85%; Guinea Pig: 85%; Horse: 85%; Human: 100%; Mouse: 85%; Pig: 78%; Rabbit: 85%; Rat: 85%
Image 1
Human MCF-7
WB Suggested Anti-DEK Antibody Titration: 0.2-1 ug/ml
ELISA Titer: 1:1562500
Positive Control: MCF7 cell lysate
 

AVIVA SYSTEMS BIOLOGY manufactures and sells quality antibody products covering genome wide proteins.

AVIVA SYSTEMS BIOLOGY
6370 Nancy Ridge Dr., Suite 104, San Diego, CA 92121 USA | Tel: (858)552-6979 | info@avivasysbio.com