PRDM1 Antibody - middle region (P100596_P050)

Data Sheet
 
Product Number P100596_P050
Product Page www.avivasysbio.com/prdm1-antibody-middle-region-p100596-p050.html
Name PRDM1 Antibody - middle region (P100596_P050)
Protein Size (# AA) 825 amino acids
Molecular Weight 92 kDa
NCBI Gene Id 639
Host Rabbit
Clonality Polyclonal
Concentration 0.5 mg/ml
Gene Full Name PR domain containing 1, with ZNF domain
Description
Alias Symbols BLIMP1, PRDI-BF1
Peptide Sequence Synthetic peptide located within the following region: VEDDISVISVVEKEILAVVRKEKEETGLKVSLQRNMGNGLLSSGCSLYES
Product Format Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Reference Diehl,S.A., (2008) J. Immunol. 180 (7), 4805-4815
Description of Target PRDM1 is a protein that acts as a repressor of beta-interferon gene expression. The protein binds specifically to the PRDI (positive regulatory domain I element) of the beta-IFN gene promoter. Transcription of this gene increases upon virus induction. Two alternatively spliced transcript variants that encode different isoforms have been reported. This gene encodes a protein that acts as a repressor of beta-interferon gene expression. The protein binds specifically to the PRDI (positive regulatory domain I element) of the beta-IFN gene promoter. Transcription of this gene increases upon virus induction. Two alternatively spliced transcript variants that encode different isoforms have been reported.
Protein Interactions PRMT5; SENP1; EHMT2; PIAS1; SUMO1; IRF2; IRF1; HDAC2; HDAC1; HIST1H1A; MS4A1; HSP90AA1; ATXN1; ELAVL1; KDM1A; IRF4; TLE2; TLE1; AES; PRMT7; HIST2H3A;
Reconstitution and Storage For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Datasheets/Manuals Printable datasheet for anti-PRDM1 (P100596_P050) antibody
Additional Information IHC Information: Pancreas
IHC Information: Spleen
Blocking Peptide For anti-PRDM1 (P100596_P050) antibody is Catalog # AAP30899 (Previous Catalog # AAPP01623)
Immunogen The immunogen is a synthetic peptide directed towards the middle region of human PRDM1
Uniprot ID Q86WM7
Protein Name PR domain zinc finger protein 1
Publications

VEGF-Mediated Induction of PRD1-BF1/Blimp1 Expression Sensitizes Tumor Vasculature to Oncolytic Virus Infection. Cancer Cell. 28, 210-24 (2015). 26212250

Protein Accession # NP_878911
Purification Affinity Purified
Nucleotide Accession # NM_182907
Tested Species Reactivity Human
Gene Symbol PRDM1
Predicted Species Reactivity Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Pig, Rabbit
Application IHC, WB
Predicted Homology Based on Immunogen Sequence Cow: 100%; Dog: 100%; Guinea Pig: 84%; Horse: 100%; Human: 100%; Mouse: 92%; Pig: 100%; Rabbit: 92%; Rat: 92%
Image 1
Human Spleen
Immunohistochemistry with Spleen cell lysate tissue at an antibody concentration of 5.0ug/ml using anti-PRDM1 antibody (P100596_P050)
Image 2
Human Pancreas
Anti-BLIMP-1 antibody IHC staining of human pancreas. Immunohistochemistry of formalin-fixed, paraffin-embedded tissue after heat-induced antigen retrieval. Antibody concentration 5 ug/ml.
Image 3

25 ug of the indicated Human whole cell extracts was loaded onto a 12% SDS-PAGE gel. 3 ug/mL of the antibody was used in this experiment. The peptide sequence is present in a 77 kDa isoform. The protein may be modified by glycosylation.
 

AVIVA SYSTEMS BIOLOGY manufactures and sells quality antibody products covering genome wide proteins.

AVIVA SYSTEMS BIOLOGY
10211 Pacific Mesa Blvd, Ste 401, San Diego, CA 92121 USA | Tel: (858)552-6979 | info@avivasysbio.com