NANOG Antibody - N-terminal region (P100591_P050)

Data Sheet
 
Product Number P100591_P050
Product Page www.avivasysbio.com/nanog-antibody-n-terminal-region-p100591-p050.html
Name NANOG Antibody - N-terminal region (P100591_P050)
Protein Size (# AA) 305 amino acids
Molecular Weight 35kDa
NCBI Gene Id 79923
Host Rabbit
Clonality Polyclonal
Concentration 0.5 mg/ml
Gene Full Name Nanog homeobox
Alias Symbols -
Peptide Sequence Synthetic peptide located within the following region: PMPVICGPEENYPSLQMSSAEMPHTETVSPLPSSMDLLIQDSPDSSTSPK
Product Format Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Reference Piestun,D., (2006) Biochem. Biophys. Res. Commun. 343 (1), 279-285
Description of Target NANOG is a new marker for testicular carcinoma in situ and germ cell tumors. Gene knockdown of Nanog promotes differentiation, thereby demonstrating a role for these factors in human embryonic stem cell self-renewal.
Protein Interactions DOT1L; UBC; ZNF281; RHOXF2; SALL4; MED12;
Reconstitution and Storage For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Datasheets/Manuals Printable datasheet for anti-NANOG (P100591_P050) antibody
Blocking Peptide For anti-NANOG (P100591_P050) antibody is Catalog # AAP30890 (Previous Catalog # AAPS00101)
Immunogen The immunogen is a synthetic peptide directed towards the N terminal region of human NANOG
Uniprot ID Q6NSW7
Protein Name Putative homeobox protein NANOGP8
Publications

Yang, C. et al. Opposing putative roles for canonical and noncanonical NFκB signaling on the survival, proliferation, and differentiation potential of human embryonic stem cells. Stem Cells 28, 1970-80 (2010). 20882529

Protein Accession # NP_079141
Purification Affinity Purified
Nucleotide Accession # NM_024865
Tested Species Reactivity Human
Gene Symbol NANOG
Predicted Species Reactivity Human, Pig
Application WB
Predicted Homology Based on Immunogen Sequence Human: 100%; Pig: 92%
Image 1
Human Jurkat
WB Suggested Anti-NANOG Antibody Titration: 0.2-1 ug/ml
ELISA Titer: 1:1562500
Positive Control: Jurkat cell lysate
 

AVIVA SYSTEMS BIOLOGY manufactures and sells quality antibody products covering genome wide proteins.

AVIVA SYSTEMS BIOLOGY
10211 Pacific Mesa Blvd, Ste 401, San Diego, CA 92121 USA | Tel: (858)552-6979 | info@avivasysbio.com