Product Number |
OPCB00002 |
Product Page |
www.avivasysbio.com/cxcl12-protein-opcb00002.html |
Name |
CXCL12 Protein (OPCB00002) |
Molecular Weight |
7.959 kDa |
NCBI Gene Id |
6387 |
Purity |
> 97% as determined by SDS-PAGE |
Source |
E. coli |
Gene Full Name |
chemokine (C-X-C motif) ligand 12 |
Alias Symbols |
IRH, PBSF, SDF1, TLSF, TPAR1, SCYB12 |
Product Format |
Lyophilized |
Reference |
1. "Structure and chromosomal localization of the human stromal cell-derived factor 1 (SDF1) gene." Shirozu M., Nakano T., Inazawa J., Tashiro K., Tada H., Shinohara T., Honjo T. Genomics 28:495-500(1995) 2. "Identification and expression of novel isoforms of human stromal cell-derived factor 1." Yu L., Cecil J., Peng S.B., Schrementi J., Kovacevic S., Paul D., Su E.W., Wang J. Gene 374:174-179(2006) 3. "Nucleotide sequence of hIRH, human intercrine reduced in hepatomas." Begum N.A., Barnard G.F. Submitted (JAN-1995) to the EMBL/GenBank/DDBJ databases 4. "Polymorphism study of cell-derived factor 1 (SDF1) gene and their correlation with HIV infection in a Chinese cohort." Zhao X., Zhang H., Lee S., Wong K., Zheng B. Submitted (DEC-2004) to the EMBL/GenBank/DDBJ databases |
Description of Target |
Chemoattractant active on T-lymphocytes, monocytes, but not neutrophils. Activates the C-X-C chemokine receptor CXCR4 to induce a rapid and transient rise in the level of intracellular calcium ions and chemotaxis. Also binds to another C-X-C chemokine receptor CXCR7, which activates the beta-arrestin pathway and acts as a scavenger receptor for SDF-1. SDF-1-beta(3-72) and SDF-1-alpha(3-67) show a reduced chemotactic activity. Binding to cell surface proteoglycans seems to inhibit formation of SDF-1-alpha(3-67) and thus to preserve activity on local sites. Acts as a positive regulator of monocyte migration and a negative regulator of monocyte adhesion via the LYN kinase. Stimulates migration of monocytes and T-lymphocytes through its receptors, CXCR4 and CXCR7, and decreases monocyte adherence to surfaces coated with ICAM-1, a ligand for beta-2 integrins. SDF1A/CXCR4 signaling axis inhibits beta-2 integrin LFA-1 mediated adhesion of monocytes to ICAM-1 through LYN kinase. Inhibits CXCR4-mediated infection by T-cell line-adapted HIV-1. Plays a protective role after myocardial infarction. Induces down-regulation and internalization of CXCR7 expressed in various cells. Has several critical functions during embryonic development; required for B-cell lymphopoiesis, myelopoiesis in bone marrow and heart ventricular septum formation. |
Reconstitution and Storage |
Store for 12 months from date of receipt; -20°C to -70°C as supplied. Spin tube prior to resuspending. Recommended at 100 ug/mL in sterile water. Use immediately after reconstitution. Store for 1 month at -20°C to -70°C under sterile conditions after reconstitution. Avoid repeated freeze/thaw cycles. |
Protein Sequence |
The protein sequence is: KPVSLSYRCPCRFFESHVARANVKHLKILNTPNCALQIVARLKNNNRQVCIDPKLKWIQEYLEKALNK |
Datasheets/Manuals |
Printable datasheet for OPCB00002 |
Additional Information |
Extinction Coefficient: 8730 M-1 cm-1 Endotoxin Level: <0.01 EU per 1ug of the protein by the LAL method |
Biological Activity |
EC50 = 0.62nM determined by Calcium Flux with human CXCR4 in U937 cells |
Uniprot ID |
P48061 |
Gene Symbol |
CXCL12 |
Application |
CA |
Image 1 | Migration Assay
| Migration Assay: Jurkat cells expressing endogenous CXCR4 were assayed for migration through a transwell filter at various concentrations of WT SDF-1 alpha. Responses are expressed as the % of total input cells |
|
|