Protein on Demand™ 4B Recombinant Protein (Bovine coronavirus) (OPCA46222)

Data Sheet
 
Product Number OPCA46222
Product Page www.avivasysbio.com/
Name Protein on Demand™ 4B Recombinant Protein (Bovine coronavirus) (OPCA46222)
Protein Size (# AA) 45 amino acids
Tag This protein may contain a N-terminal tag or C-terminal tag based on protein stability requirements.
Purity Greater than 85% as determined by SDS-PAGE.
Product Format Lyophilized powder
Reconstitution and Storage Briefly centrifuge lyophilized product prior to opening to bring the contents to the bottom. Please reconstitute protein to 0.1-1.0 mg/mL by adding deionized sterile water first, followed by addition of glycerol to a final concentration of 5-50%. Reconstituted product should be aliquoted for long-term storage at -20C/-80C. Our in house default final concentration of glycerol is 50% for reference. The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20C/-80C. The shelf life of lyophilized form is 12 months at -20C/-80C. Repeated freezing and thawing is not recommended. Store working aliquots at 4C for up to one week.
Protein Sequence MPMATTIEGADYTNIMPITVLTTVYLGVSIGIDTSTTGFTCFSRY
Datasheets/Manuals Printable datasheet for OPCA46222
Additional Information For Research Use Only.
Sterile filtering available upon request.
Low endotoxin available upon request.
Storage Buffer Tris/PBS-based buffer, 6% Trehalose, pH 8.0
Uniprot ID P0C2R2
Gene Symbol 4B
Predicted Species Reactivity Bovine coronavirus
Application WB, ELISA
Image 1
POD_FAQ
 

AVIVA SYSTEMS BIOLOGY manufactures and sells quality antibody products covering genome wide proteins.

AVIVA SYSTEMS BIOLOGY
6370 Nancy Ridge Dr., Suite 104, San Diego, CA 92121 USA | Tel: (858)552-6979 | info@avivasysbio.com