| Product Number |
OPCA39305 |
| Product Page |
www.avivasysbio.com/ |
| Name |
Protein on Demand™ RPSU1 Recombinant Protein (Burkholderia pseudomallei) (OPCA39305) |
| Protein Size (# AA) |
70 amino acids |
| Purity |
Greater than 85% as determined by SDS-PAGE. |
| Protein Range |
25569 |
| Product Format |
Liquid |
| Reconstitution and Storage |
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20C/-80C. The shelf life of lyophilized form is 12 months at -20C/-80C. Repeated freezing and thawing is not recommended. Store working aliquots at 4C for up to one week. |
| Protein Sequence |
MTTILLKENEPFEVAIRRFRRAIEKNGLIAELRERQAYEKPTAVRKRKKAAAVKRLHKRLRSQMLPKKLH |
| Datasheets/Manuals |
Printable datasheet for OPCA39305 |
| Additional Information |
For Research Use Only.
Sterile filtering available upon request.
Low endotoxin available upon request. |
| Storage Buffer |
Tris-based buffer,50% glycerol |
| Uniprot ID |
P70943 |
| Protein Name |
30S ribosomal protein S21 1 |
| Predicted Species Reactivity |
Burkholderia pseudomallei |
| Application |
WB, ELISA |
| Image 1 | POD_FAQ
 | |
|
|
