| Product Number |
OPCA335446 |
| Product Page |
www.avivasysbio.com/ |
| Name |
Protein on Demand™ HBA1 Recombinant Protein (Przewalski's horse) (OPCA335446) |
| Protein Size (# AA) |
141 amino acids |
| NCBI Gene Id |
103563135 |
| Purity |
Greater than 85% as determined by SDS-PAGE. |
| Protein Range |
2-142 |
| Alias Symbols |
HBA |
| Product Format |
Liquid |
| Reconstitution and Storage |
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20C/-80C. The shelf life of lyophilized form is 12 months at -20C/-80C. Repeated freezing and thawing is not recommended. Store working aliquots at 4C for up to one week. |
| Protein Sequence |
VLSAADKTNVKAAWSKVGGHAGEFGAEALERMFLGFPTTKTYFPHFDLSHGSAQVKAHGKKVGDALTLAVGHLDDLPGALSNLSDLHAHKLRVDPVNFKLLSHCLLSTLAVHLPNDFTPAVHASLDKFLSSVSTVLTSKYR |
| Datasheets/Manuals |
Printable datasheet for OPCA335446 |
| Storage Buffer |
Tris-based buffer,50% glycerol |
| Uniprot ID |
Q9XSE9 |
| Protein Name |
hemoglobin subunit alpha |
| Predicted Species Reactivity |
Przewalski's horse |
| Application |
WB, ELISA |
| Image 1 | POD_FAQ
 | |
|
|
