Protein on Demand™ LDHA Recombinant Protein (Red-eared slider turtle) (OPCA330217)

• Product Number: OPCA330217
• Name: Protein on Demand™ LDHA Recombinant Protein (Red-eared slider turtle) (OPCA330217)
• Protein Size (# AA): 331 amino acids
• Purity: Greater than 85% as determined by SDS-PAGE.
• Protein Range: 2-332
• Product Format: Liquid
• Reconstitution and Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20C/-80C. The shelf life of lyophilized form is 12 months at -20C/-80C. Repeated freezing and thawing is not recommended. Store working aliquots at 4C for up to one week.
• Protein Sequence: SVKELLIQNVHKEEHSHAHNKITVVGVGAVGMACAISILMKDLADELALVDVIEDKLRGEMLDLQHGSLFLRTPKIVSGKDYSVTAHSKLVIITAGARQQEGESRLNLVQRNVNIFKFIIPNVVKHSPDCTLLVVSNPVDILTYVAWKISGFPKHRVIGSGCNLDSARFRYLMGGKLGIHSLSCHGWIIGEHGDSSVPVWSGVNVAGVSLKALYPDLGTDADKEHWKEVHKQVVDSAYEVIKLKGYTSWAIGLSVADLAETIMRNLRRVHPISTMVKGMYGIHDDVFLSVPCVLGYSGITDVVKMTLKSEEEEKLRKSADTLWGIQKELQF
• Storage Buffer: Tris-based buffer,50% glycerol
• Uniprot ID: Q9PT43
• Predicted Species Reactivity: Red-eared slider turtle
• Application: WB, ELISA
• Image 1: POD_FAQ