| Product Number |
OPCA327759 |
| Product Page |
www.avivasysbio.com/ |
| Name |
Protein on Demand™ MRPL28 Recombinant Protein (Mouse) (OPCA327759) |
| Protein Size (# AA) |
202 amino acids |
| NCBI Gene Id |
68611 |
| Purity |
Greater than 85% as determined by SDS-PAGE. |
| Gene Full Name |
mitochondrial ribosomal protein L28 |
| Protein Range |
56-257 |
| Alias Symbols |
p15, L28mt, MAAT1, MRP-L28, 1110015G04Rik |
| Product Format |
Liquid |
| Description of Target |
Mammalian mitochondrial ribosomal proteins are encoded by nuclear genes and help in protein synthesis within the mitochondrion. Mitochondrial ribosomes (mitoribosomes) consist of a small 28S subunit and a large 39S subunit. They have an estimated 75% prot |
| Reconstitution and Storage |
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20C/-80C. The shelf life of lyophilized form is 12 months at -20C/-80C. Repeated freezing and thawing is not recommended. Store working aliquots at 4C for up to one week. |
| Protein Sequence |
NGQRERVEDVPIPVHYPPESQQGLWGGEGLILGYRYANNDKLSKRVKKVWKPQLFTRELYSEILDKKFTVTVTMRTLDLIDEAYGFDFYILKTPKEDLGSKFGMDLKRGMLLRLARQDPHLHPENPERRAAIYDKYRSFVIPEAEAEWVGLTLEEALEKQRLLEEKDPVPLFKVYVEELVQRLQEQVLSRPAVVQKRAGDHA |
| Datasheets/Manuals |
Printable datasheet for OPCA327759 |
| Additional Information |
For Research Use Only.
Sterile filtering available upon request.
Low endotoxin available upon request. |
| Storage Buffer |
Tris-based buffer,50% glycerol |
| Uniprot ID |
Q9D1B9 |
| Protein Name |
39S ribosomal protein L28, mitochondrial |
| Predicted Species Reactivity |
Mouse |
| Application |
WB, ELISA |
| Image 1 | POD_FAQ
 | |
|
|
