Protein on Demand™ MAFF_RS22740 Recombinant Protein (Rhizobium loti) (OPCA311184)

Data Sheet
 
Product Number OPCA311184
Product Page www.avivasysbio.com/
Name Protein on Demand™ MAFF_RS22740 Recombinant Protein (Rhizobium loti) (OPCA311184)
Protein Size (# AA) 233 amino acids
NCBI Gene Id 1228854
Purity Greater than 85% as determined by SDS-PAGE.
Protein Range 1-233
Product Format Liquid
Reconstitution and Storage The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20C/-80C. The shelf life of lyophilized form is 12 months at -20C/-80C. Repeated freezing and thawing is not recommended. Store working aliquots at 4C for up to one week.
Protein Sequence MSPQDRPSRTTEAFFGRRRGKPVRPQQAAALESGLDAYRLDLTADAPSDLRTLFETEVSAVRLEIGFGGGEHLLHRAIEAPTTGFIGVEPFVNGMAKMMMAVRARPLANLRVHDDDATRLLDWLPPASLGGIDLLYPDPWPKKKHWKRRFVSPVNLERFARVLKPGAKFRFASDIDTYVNWTLLHCRAHGAFAWQAAEAADWHRPYEGWPGTRYEAKAIREGRRPAYLTFVRK
Datasheets/Manuals Printable datasheet for OPCA311184
Additional Information For Research Use Only.
Sterile filtering available upon request.
Low endotoxin available upon request.
Storage Buffer Tris-based buffer,50% glycerol
Uniprot ID Q98BJ3
Predicted Species Reactivity Rhizobium loti
Application WB, ELISA
Image 1
POD_FAQ
 

AVIVA SYSTEMS BIOLOGY manufactures and sells quality antibody products covering genome wide proteins.

AVIVA SYSTEMS BIOLOGY
10211 Pacific Mesa Blvd, Ste 401, San Diego, CA 92121 USA | Tel: (858)552-6979 | info@avivasysbio.com