Protein on Demand™ FOXF2 Recombinant Protein (Human) (OPCA211402)

Data Sheet
 
Product Number OPCA211402
Product Page www.avivasysbio.com/
Name Protein on Demand™ FOXF2 Recombinant Protein (Human) (OPCA211402)
Protein Size (# AA) 444 amino acids
NCBI Gene Id 2295
Purity Greater than 85% as determined by SDS-PAGE.
Gene Full Name forkhead box F2
Protein Range 1-444
Alias Symbols FKHL6, FREAC2, FREAC-2
Product Format Liquid
Description of Target FOXF2 encodes forkhead box F2, one of many human homologues of the Drosophila melanogaster transcription factor forkhead. FOXF2 is expressed in lung and placenta, and has been shown to transcriptionally activate several lung-specific genes.
Reconstitution and Storage The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20C/-80C. The shelf life of lyophilized form is 12 months at -20C/-80C. Repeated freezing and thawing is not recommended. Store working aliquots at 4C for up to one week.
Protein Sequence MTTEGGPPPAPLRRACSPVPGALQAALMSPPPAAAAAAAAAPETTSSSSSSSSASCASSSSSSNSASAPSAACKSAGGGGAGAGSGGAKKASSGLRRPEKPPYSYIALIVMAIQSSPSKRLTLSEIYQFLQARFPFFRGAYQGWKNSVRHNLSLNECFIKLPKGLGRPGKGHYWTIDPASEFMFEEGSFRRRPRGFRRKCQALKPMYHRVVSGLGFGASLLPQGFDFQAPPSAPLGCHSQGGYGGLDMMPAGYDAGAGAPSHAHPHHHHHHHVPHMSPNPGSTYMASCPVPAGPGGVGAAGGGGGGDYGPDSSSSPVPSSPAMASAIECHSPYTSPAAHWSSPGASPYLKQPPALTPSSNPAASAGLHSSMSSYSLEQSYLHQNAREDLSVGLPRYQHHSTPVCDRKDFVLNFNGISSFHPSASGSYYHHHHQSVCQDIKPCVM
Datasheets/Manuals Printable datasheet for OPCA211402
Storage Buffer Tris-based buffer,50% glycerol
Uniprot ID Q12947
Protein Name forkhead box protein F2
Protein Accession # NP_001443.1
Nucleotide Accession # NM_001452.1
Predicted Species Reactivity Human
Application WB, ELISA
Image 1
POD_FAQ
 

AVIVA SYSTEMS BIOLOGY manufactures and sells quality antibody products covering genome wide proteins.

AVIVA SYSTEMS BIOLOGY
10211 Pacific Mesa Blvd, Ste 401, San Diego, CA 92121 USA | Tel: (858)552-6979 | info@avivasysbio.com