Product Number |
OPCA211402 |
Product Page |
www.avivasysbio.com/ |
Name |
Protein on Demand™ FOXF2 Recombinant Protein (Human) (OPCA211402) |
Protein Size (# AA) |
444 amino acids |
NCBI Gene Id |
2295 |
Purity |
Greater than 85% as determined by SDS-PAGE. |
Gene Full Name |
forkhead box F2 |
Protein Range |
1-444 |
Alias Symbols |
FKHL6, FREAC2, FREAC-2 |
Product Format |
Liquid |
Description of Target |
FOXF2 encodes forkhead box F2, one of many human homologues of the Drosophila melanogaster transcription factor forkhead. FOXF2 is expressed in lung and placenta, and has been shown to transcriptionally activate several lung-specific genes. |
Reconstitution and Storage |
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20C/-80C. The shelf life of lyophilized form is 12 months at -20C/-80C. Repeated freezing and thawing is not recommended. Store working aliquots at 4C for up to one week. |
Protein Sequence |
MTTEGGPPPAPLRRACSPVPGALQAALMSPPPAAAAAAAAAPETTSSSSSSSSASCASSSSSSNSASAPSAACKSAGGGGAGAGSGGAKKASSGLRRPEKPPYSYIALIVMAIQSSPSKRLTLSEIYQFLQARFPFFRGAYQGWKNSVRHNLSLNECFIKLPKGLGRPGKGHYWTIDPASEFMFEEGSFRRRPRGFRRKCQALKPMYHRVVSGLGFGASLLPQGFDFQAPPSAPLGCHSQGGYGGLDMMPAGYDAGAGAPSHAHPHHHHHHHVPHMSPNPGSTYMASCPVPAGPGGVGAAGGGGGGDYGPDSSSSPVPSSPAMASAIECHSPYTSPAAHWSSPGASPYLKQPPALTPSSNPAASAGLHSSMSSYSLEQSYLHQNAREDLSVGLPRYQHHSTPVCDRKDFVLNFNGISSFHPSASGSYYHHHHQSVCQDIKPCVM |
Datasheets/Manuals |
Printable datasheet for OPCA211402 |
Storage Buffer |
Tris-based buffer,50% glycerol |
Uniprot ID |
Q12947 |
Protein Name |
forkhead box protein F2 |
Protein Accession # |
NP_001443.1 |
Nucleotide Accession # |
NM_001452.1 |
Predicted Species Reactivity |
Human |
Application |
WB, ELISA |
Image 1 | POD_FAQ
| |
|
|