Product Number |
OPCA102836 |
Product Page |
www.avivasysbio.com/ |
Name |
Protein on Demand™ YCF3 Recombinant Protein (Chulantree) (OPCA102836) |
Protein Size (# AA) |
#VALUE! amino acids |
NCBI Gene Id |
5236436 |
Purity |
Greater than 85% as determined by SDS-PAGE. |
Protein Range |
1-168
|
Product Format |
Liquid |
Reconstitution and Storage |
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20C/-80C. The shelf life of lyophilized form is 12 months at -20C/-80C. Repeated freezing and thawing is not recommended. Store working aliquots at 4C for up to one week. |
Protein Sequence |
MPRSRINGNFIDKTFSIVANILLRIIPTTSGEKEAFTYYRDGMSAQSDGNYAEALQNYYEATRLEIDPYDRSYILYNIGLIHTSNGEHTKALEYYFRALERNPFLPQAFNNMAVICHYRGEQAIRQGDSEIAEAWSDQAAEYWKQAIALTPGNYIEAHNWLKITRRFE |
Datasheets/Manuals |
Printable datasheet for OPCA102836 |
Storage Buffer |
Tris-based buffer,50% glycerol |
Uniprot ID |
A6MMC3 |
Predicted Species Reactivity |
Chulantree |
Application |
WB, ELISA |
Image 1 | POD_FAQ
| |
|
|