Product Number |
OPCA05415 |
Product Page |
www.avivasysbio.com/tes-26-recombinant-protein-canine-roundworm-opca05415.html |
Name |
TES-26 Recombinant Protein (Canine roundworm) (OPCA05415) |
Protein Size (# AA) |
Recombinant amino acids |
Molecular Weight |
27.9 kDa |
Tag |
C-terminal 9xHis-tagged |
Purity |
Greater than 90% as determined by SDS-PAGE. |
Source |
Baculovirus |
Protein Range |
22-262 aa |
Alias Symbols |
Toxocara excretory-secretory antigen 26. |
Peptide Sequence |
QCMDSASDCAANAGSCFTRPVSQVLQNRCQRTCNTCDCRDEANNCAASINLCQNPTFEPLVRDRCQKTCGLCAGCGFISSGIVPLVVTSAPSRRVSVTFANNVQVNCGNTLTTAQVANQPTVTWEAQPNDRYTLIMVDPDFPSAANGQQGQRLHWWVINIPGNNIAGGTTLAAFQPSTPAANTGVHRYVFLVYRQPAAINSPLLNNLVVQDSERPGFGTTAFATQFNLGSPYAGNFYRSQA |
Product Format |
Liquid or Lyophilized powder |
Reference |
An abundant, trans-spliced mRNA from Toxocara canis infective larvae encodes a 26-KDA protein with homology to phosphatidylethanolamine-binding proteins.Gems D., Ferguson C.J., Robertson B.D., Nieves R., Page A.P., Blaxter M.L., Maizels R.M.J. Biol. Chem. 270:18517-18522(1995). |
Description of Target |
Binds phosphatidylethanolamine. |
Reconstitution and Storage |
-20°C or -80°C |
Protein Sequence |
QCMDSASDCAANAGSCFTRPVSQVLQNRCQRTCNTCDCRDEANNCAASINLCQNPTFEPLVRDRCQKTCGLCAGCGFISSGIVPLVVTSAPSRRVSVTFANNVQVNCGNTLTTAQVANQPTVTWEAQPNDRYTLIMVDPDFPSAANGQQGQRLHWWVINIPGNNIAGGTTLAAFQPSTPAANTGVHRYVFLVYRQPAAINSPLLNNLVVQDSERPGFGTTAFATQFNLGSPYAGNFYRSQA |
Datasheets/Manuals |
Printable datasheet for TES-26 Recombinant Protein (Canine roundworm) (OPCA05415) (OPCA05415) |
Additional Information |
Species Specificity Detail: Toxocara canis |
Formulation |
Tris-base, 50% glycerol |
Storage Buffer |
If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol.
If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
Uniprot ID |
P54190 |
Protein Name |
26 kDa secreted antigen |
Gene Symbol |
TES-26 |
Predicted Species Reactivity |
Toxocara canis |
Image 1 | |
|