TES-26 Recombinant Protein (Canine roundworm) (OPCA05415)

Data Sheet
 
Product Number OPCA05415
Product Page www.avivasysbio.com/tes-26-recombinant-protein-canine-roundworm-opca05415.html
Name TES-26 Recombinant Protein (Canine roundworm) (OPCA05415)
Protein Size (# AA) Recombinant amino acids
Molecular Weight 27.9 kDa
Tag C-terminal 9xHis-tagged
Purity Greater than 90% as determined by SDS-PAGE.
Source Baculovirus
Protein Range 22-262 aa
Alias Symbols Toxocara excretory-secretory antigen 26.
Peptide Sequence QCMDSASDCAANAGSCFTRPVSQVLQNRCQRTCNTCDCRDEANNCAASINLCQNPTFEPLVRDRCQKTCGLCAGCGFISSGIVPLVVTSAPSRRVSVTFANNVQVNCGNTLTTAQVANQPTVTWEAQPNDRYTLIMVDPDFPSAANGQQGQRLHWWVINIPGNNIAGGTTLAAFQPSTPAANTGVHRYVFLVYRQPAAINSPLLNNLVVQDSERPGFGTTAFATQFNLGSPYAGNFYRSQA
Product Format Liquid or Lyophilized powder
Reference An abundant, trans-spliced mRNA from Toxocara canis infective larvae encodes a 26-KDA protein with homology to phosphatidylethanolamine-binding proteins.Gems D., Ferguson C.J., Robertson B.D., Nieves R., Page A.P., Blaxter M.L., Maizels R.M.J. Biol. Chem. 270:18517-18522(1995).
Description of Target Binds phosphatidylethanolamine.
Reconstitution and Storage -20°C or -80°C
Protein Sequence QCMDSASDCAANAGSCFTRPVSQVLQNRCQRTCNTCDCRDEANNCAASINLCQNPTFEPLVRDRCQKTCGLCAGCGFISSGIVPLVVTSAPSRRVSVTFANNVQVNCGNTLTTAQVANQPTVTWEAQPNDRYTLIMVDPDFPSAANGQQGQRLHWWVINIPGNNIAGGTTLAAFQPSTPAANTGVHRYVFLVYRQPAAINSPLLNNLVVQDSERPGFGTTAFATQFNLGSPYAGNFYRSQA
Datasheets/Manuals Printable datasheet for TES-26 Recombinant Protein (Canine roundworm) (OPCA05415) (OPCA05415)
Additional Information Species Specificity Detail: Toxocara canis
Formulation Tris-base, 50% glycerol
Storage Buffer If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Uniprot ID P54190
Protein Name 26 kDa secreted antigen
Gene Symbol TES-26
Predicted Species Reactivity Toxocara canis
Image 1

 

AVIVA SYSTEMS BIOLOGY manufactures and sells quality antibody products covering genome wide proteins.

AVIVA SYSTEMS BIOLOGY
10211 Pacific Mesa Blvd, Ste 401, San Diego, CA 92121 USA | Tel: (858)552-6979 | info@avivasysbio.com