| Product Number |
OPCA05270 |
| Product Page |
www.avivasysbio.com/scytovirin-recombinant-protein-blood-fluke-opca05270.html |
| Name |
SCYTOVIRIN Recombinant Protein (Blood fluke) (OPCA05270) |
| Protein Size (# AA) |
Recombinant amino acids |
| Molecular Weight |
23.7 kDa |
| Tag |
N-terminal 6xHis-B2M-tagged |
| Purity |
Greater than 90% as determined by SDS-PAGE. |
| Source |
E.coli |
| Protein Range |
1-95 aa |
| Alias Symbols |
Scytovirin, SVN |
| Peptide Sequence |
GSGPTYCWNEANNPGGPNRCSNNKQCDGARTCSSSGFCQGTSRKPDPGPKGPTYCWDEAKNPGGPNRCSNSKQCDGARTCSSSGFCQGTAGHAAA |
| Product Format |
Liquid or Lyophilized powder |
| Reference |
A potent novel anti-HIV protein from the cultured cyanobacterium Scytonema varium. Bokesch H.R., O'Keefe B.R., McKee T.C., Pannell L.K., Patterson G.M.L., Gardella R.S., Sowder R.C. II, Turpin J., Watson K., Buckheit R.W. Jr., Boyd M.R. Biochemistry 42:2578-2584(2003) |
| Description of Target |
Has strong anti-HIV activity against T-tropic strains of HIV-1 and weaker activity against M-tropic strains of HIV-1. Inhibits HIV-1 fusion and infection of CD4 LTR beta-gal cells in vitro. Inhibits fusion of HIV infected CEM-SS cells with uninfected CEM-SS cells, and fusion of HIV-1 Env expressing HL2/3 cells with CD4 LTR beta-gal cells. Binds to HIV gp120, HIV gp160 and to a lesser extent HIV gp41. Binding to HIV gp120 is glycosylation dependent. Binds with high specificity to the tetrasaccharide Man-alpha-1,2-Man-alpha-1,6-Man-alpha-1,6-Man and also binds the higher-order oligosaccharides oligomannose 8 and oligomannose 9. Does not bind to monosaccharides, complex or hybrid N-linked oligosaccharides or chitin. |
| Reconstitution and Storage |
-20°C or -80°C |
| Protein Sequence |
GSGPTYCWNEANNPGGPNRCSNNKQCDGARTCSSSGFCQGTSRKPDPGPKGPTYCWDEAKNPGGPNRCSNSKQCDGARTCSSSGFCQGTAGHAAA |
| Datasheets/Manuals |
Printable datasheet for SCYTOVIRIN Recombinant Protein (Blood fluke) (OPCA05270) (OPCA05270) |
| Additional Information |
Species Specificity Detail: Schistosoma mansoni (Blood fluke) |
| Formulation |
Tris-base, 50% glycerol |
| Storage Buffer |
If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol.
If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
| Uniprot ID |
P86041 |
| Protein Name |
Scytovirin |
| Predicted Species Reactivity |
Schistosoma mansoni|Scytonema varium |
| Image 1 | |
|
