| Product Number |
OPCA05204 |
| Product Page |
www.avivasysbio.com/snake-venom-metalloproteinase-adamalysin-2-recombinant-protein-eastern-diamondback-rattlesnake-opca05204.html |
| Name |
SNAKE VENOM METALLOPROTEINASE ADAMALYSIN-2 Recombinant Protein (Eastern diamondback rattlesnake) (OPCA05204) |
| Protein Size (# AA) |
Recombinant amino acids |
| Molecular Weight |
27.1 kDa |
| Tag |
N-terminal 6xHis-tagged |
| Purity |
Greater than 90% as determined by SDS-PAGE. |
| Source |
E.coli |
| Alias Symbols |
Adamalysin II;Proteinase II. |
| Peptide Sequence |
QQNLPQRYIELVVVADRRVFMKYNSDLNIIRTRVHEIVNIINGFYRSLNIDVSLVNLEIWSGQDPLTIQSSSSNTLNSEGLWREKVLLNKKKKDNAQLLTAIEFKCETLGKAYLNSMCNPRSSVGIVKDHSPINLLVAVTMAHELGHNLGMEHDGKDCLRGASLCIMRPGLTPGRSYEFSDDSMGYYQKFLNQYKPQCILNKP |
| Product Format |
Liquid or Lyophilized powder |
| Reference |
First structure of a snake venom metalloproteinase: a prototype for matrix metalloproteinases/collagenases. Gomis-Rueth F.-X., Kress L.F., Bode W. EMBO J. 12:4151-4157(1993) |
| Description of Target |
Has no significant hemorrhagic activity, but inactivates serpins by limited proteolysis of their reactive-site loops. |
| Reconstitution and Storage |
-20°C or -80°C |
| Protein Sequence |
Full Length: QQNLPQRYIELVVVADRRVFMKYNSDLNIIRTRVHEIVNIINGFYRSLNIDVSLVNLEIWSGQDPLTIQSSSSNTLNSEGLWREKVLLNKKKKDNAQLLTAIEFKCETLGKAYLNSMCNPRSSVGIVKDHSPINLLVAVTMAHELGHNLGMEHDGKDCLRGASLCIMRPGLTPGRSYEFSDDSMGYYQKFLNQYKPQCILNKP |
| Datasheets/Manuals |
Printable datasheet for SNAKE VENOM METALLOPROTEINASE ADAMALYSIN-2 Recombinant Protein (Eastern diamondback rattlesnake) (OPCA05204) (OPCA05204) |
| Uniprot ID |
P34179 |
| Protein Name |
Snake venom metalloproteinase adamalysin-2 |
| Purification |
Affinity purified using IMAC |
| Predicted Species Reactivity |
Crotalus adamanteus |
| Image 1 | |
|
