Product Number |
OPCA05160 |
Product Page |
www.avivasysbio.com/aadac-recombinant-protein-human-opca05160.html |
Name |
AADAC Recombinant Protein (Human) (OPCA05160) |
Protein Size (# AA) |
Recombinant amino acids |
Molecular Weight |
63.1 kDa |
Tag |
N-terminal 10xHis-SUMO-tagged and C-terminal Myc-tagged |
NCBI Gene Id |
13 |
Purity |
Greater than 90% as determined by SDS-PAGE. |
Source |
E.coli |
Gene Full Name |
arylacetamide deacetylase |
Protein Range |
24-399 aa |
Alias Symbols |
arylacetamide deacetylase;arylacetamide deacetylase (esterase);CES5A1;DAC. |
Peptide Sequence |
PDNVEEPWRMMWINAHLKTIQNLATFVELLGLHHFMDSFKVVGSFDEVPPTSDENVTVTETKFNNILVRVYVPKRKSEALRRGLFYIHGGGWCVGSAALSGYDLLSRWTADRLDAVVVSTNYRLAPKYHFPIQFEDVYNALRWFLRKKVLAKYGVNPERIGISGDSAGGNLAAAVTQQLLDDPDVKIKLKIQSLIYPALQPLDVDLPSYQENSNFLFLSKSLMVRFWSEYFTTDRSLEKAMLSRQHVPVESSHLFKFVNWSSLLPERFIKGHVYNNPNYGSSELAKKYPGFLDVRAAPLLADDNKLRGLPLTYVITCQYDLLRDDGLMYVTRLRNTGVQVTHNHVEDGFHGAFSFLGLKISHRLINQYIEWLKENL |
Product Format |
Liquid or Lyophilized powder |
Reference |
Human liver arylacetamide deacetylase. Molecular cloning of a novel esterase involved in the metabolic activation of arylamine carcinogens with high sequence similarity to hormone-sensitive lipase. Probst M.R., Beer M., Beer D., Jenoe P., Meyer U.A., Gasser R. J. Biol. Chem. 269:21650-21656(1994) |
Description of Target |
Displays cellular triglyceride lipase activity in liver, increases the levels of intracellular fatty acids derived from the hydrolysis of newly formed triglyceride stores and plays a role in very low-density lipoprotein assembly. Displays serine esterase activity in liver. Deacetylates a variety of arylacetamide substrates, including xenobiotic compounds and procarcinogens, converting them to the primary arylamide compounds and increasing their toxicity. |
Reconstitution and Storage |
-20°C or -80°C |
Protein Sequence |
PDNVEEPWRMMWINAHLKTIQNLATFVELLGLHHFMDSFKVVGSFDEVPPTSDENVTVTETKFNNILVRVYVPKRKSEALRRGLFYIHGGGWCVGSAALSGYDLLSRWTADRLDAVVVSTNYRLAPKYHFPIQFEDVYNALRWFLRKKVLAKYGVNPERIGISGDSAGGNLAAAVTQQLLDDPDVKIKLKIQSLIYPALQPLDVDLPSYQENSNFLFLSKSLMVRFWSEYFTTDRSLEKAMLSRQHVPVESSHLFKFVNWSSLLPERFIKGHVYNNPNYGSSELAKKYPGFLDVRAAPLLADDNKLRGLPLTYVITCQYDLLRDDGLMYVTRLRNTGVQVTHNHVEDGFHGAFSFLGLKISHRLINQYIEWLKENL |
Datasheets/Manuals |
Printable datasheet for AADAC Recombinant Protein (Human) (OPCA05160) (OPCA05160) |
Additional Information |
Species Specificity Detail: Homo sapiens (Human) |
Formulation |
Tris-base, 50% glycerol |
Storage Buffer |
If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol.
If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
Uniprot ID |
P22760 |
Protein Name |
Arylacetamide deacetylase |
Protein Accession # |
NP_001077 |
Nucleotide Accession # |
NM_001086 |
Gene Symbol |
AADAC |
Predicted Species Reactivity |
Homo sapiens|Human |
Image 1 | |
|