AADAC Recombinant Protein (Human) (OPCA05160)

Data Sheet
 
Product Number OPCA05160
Product Page www.avivasysbio.com/aadac-recombinant-protein-human-opca05160.html
Name AADAC Recombinant Protein (Human) (OPCA05160)
Protein Size (# AA) Recombinant amino acids
Molecular Weight 63.1 kDa
Tag N-terminal 10xHis-SUMO-tagged and C-terminal Myc-tagged
NCBI Gene Id 13
Purity Greater than 90% as determined by SDS-PAGE.
Source E.coli
Gene Full Name arylacetamide deacetylase
Protein Range 24-399 aa
Alias Symbols arylacetamide deacetylase;arylacetamide deacetylase (esterase);CES5A1;DAC.
Peptide Sequence PDNVEEPWRMMWINAHLKTIQNLATFVELLGLHHFMDSFKVVGSFDEVPPTSDENVTVTETKFNNILVRVYVPKRKSEALRRGLFYIHGGGWCVGSAALSGYDLLSRWTADRLDAVVVSTNYRLAPKYHFPIQFEDVYNALRWFLRKKVLAKYGVNPERIGISGDSAGGNLAAAVTQQLLDDPDVKIKLKIQSLIYPALQPLDVDLPSYQENSNFLFLSKSLMVRFWSEYFTTDRSLEKAMLSRQHVPVESSHLFKFVNWSSLLPERFIKGHVYNNPNYGSSELAKKYPGFLDVRAAPLLADDNKLRGLPLTYVITCQYDLLRDDGLMYVTRLRNTGVQVTHNHVEDGFHGAFSFLGLKISHRLINQYIEWLKENL
Product Format Liquid or Lyophilized powder
Reference Human liver arylacetamide deacetylase. Molecular cloning of a novel esterase involved in the metabolic activation of arylamine carcinogens with high sequence similarity to hormone-sensitive lipase. Probst M.R., Beer M., Beer D., Jenoe P., Meyer U.A., Gasser R. J. Biol. Chem. 269:21650-21656(1994)
Description of Target Displays cellular triglyceride lipase activity in liver, increases the levels of intracellular fatty acids derived from the hydrolysis of newly formed triglyceride stores and plays a role in very low-density lipoprotein assembly. Displays serine esterase activity in liver. Deacetylates a variety of arylacetamide substrates, including xenobiotic compounds and procarcinogens, converting them to the primary arylamide compounds and increasing their toxicity.
Reconstitution and Storage -20°C or -80°C
Protein Sequence PDNVEEPWRMMWINAHLKTIQNLATFVELLGLHHFMDSFKVVGSFDEVPPTSDENVTVTETKFNNILVRVYVPKRKSEALRRGLFYIHGGGWCVGSAALSGYDLLSRWTADRLDAVVVSTNYRLAPKYHFPIQFEDVYNALRWFLRKKVLAKYGVNPERIGISGDSAGGNLAAAVTQQLLDDPDVKIKLKIQSLIYPALQPLDVDLPSYQENSNFLFLSKSLMVRFWSEYFTTDRSLEKAMLSRQHVPVESSHLFKFVNWSSLLPERFIKGHVYNNPNYGSSELAKKYPGFLDVRAAPLLADDNKLRGLPLTYVITCQYDLLRDDGLMYVTRLRNTGVQVTHNHVEDGFHGAFSFLGLKISHRLINQYIEWLKENL
Datasheets/Manuals Printable datasheet for AADAC Recombinant Protein (Human) (OPCA05160) (OPCA05160)
Additional Information Species Specificity Detail: Homo sapiens (Human)
Formulation Tris-base, 50% glycerol
Storage Buffer If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Uniprot ID P22760
Protein Name Arylacetamide deacetylase
Protein Accession # NP_001077
Nucleotide Accession # NM_001086
Gene Symbol AADAC
Predicted Species Reactivity Homo sapiens|Human
Image 1

 

AVIVA SYSTEMS BIOLOGY manufactures and sells quality antibody products covering genome wide proteins.

AVIVA SYSTEMS BIOLOGY
10211 Pacific Mesa Blvd, Ste 401, San Diego, CA 92121 USA | Tel: (858)552-6979 | info@avivasysbio.com