| Product Number |
OPCA05078 |
| Product Page |
www.avivasysbio.com/sod1-recombinant-protein-zebrafish-opca05078.html |
| Name |
SOD1 Recombinant Protein (Zebrafish) (OPCA05078) |
| Protein Size (# AA) |
Recombinant amino acids |
| Molecular Weight |
37.1 kDa |
| Tag |
N-terminal 10xHis-SUMO-tagged and C-terminal Myc-tagged |
| NCBI Gene Id |
30553 |
| Purity |
Greater than 90% as determined by SDS-PAGE. |
| Source |
E.coli |
| Gene Full Name |
superoxide dismutase 1, soluble |
| Protein Range |
1-154 aa |
| Alias Symbols |
Cu/Zn-;Cu/Zn-SOD;cuz;cuzn;Cu-Zn superoxide dismutase;sod(Cu/;sod(Cu/Zn);superoxide dismutase [Cu-Zn];ZS;ZSOD. |
| Peptide Sequence |
MVNKAVCVLKGTGEVTGTVYFNQEGEKKPVKVTGEITGLTPGKHGFHVHAFGDNTNGCISAGPHFNPHDKTHGGPTDSVRHVGDLGNVTADASGVAKIEIEDAMLTLSGQHSIIGRTMVIHEKEDDLGKGGNEESLKTGNAGGRLACGVIGITQ |
| Product Format |
Liquid or Lyophilized powder |
| Reference |
Comparative effects of dietary methylmercury on gene expression in liver, skeletal muscle, and brain of the zebrafish (Danio rerio). Gonzalez P., Dominique Y., Massabuau J.C., Boudou A., Bourdineaud J.P. Environ. Sci. Technol. 39:3972-3980(2005) |
| Description of Target |
Destroys radicals which are normally produced within the cells and which are toxic to biological systems. |
| Reconstitution and Storage |
-20°C or -80°C |
| Protein Sequence |
MVNKAVCVLKGTGEVTGTVYFNQEGEKKPVKVTGEITGLTPGKHGFHVHAFGDNTNGCISAGPHFNPHDKTHGGPTDSVRHVGDLGNVTADASGVAKIEIEDAMLTLSGQHSIIGRTMVIHEKEDDLGKGGNEESLKTGNAGGRLACGVIGITQ |
| Datasheets/Manuals |
Printable datasheet for SOD1 Recombinant Protein (Zebrafish) (OPCA05078) (OPCA05078) |
| Additional Information |
Species Specificity Detail: Danio rerio (Zebrafish) (Brachydanio rerio) |
| Formulation |
Tris-base, 50% glycerol |
| Storage Buffer |
If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol.
If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
| Uniprot ID |
O73872 |
| Protein Name |
Superoxide dismutase [Cu-Zn] |
| Protein Accession # |
NP_571369 |
| Nucleotide Accession # |
NM_131294 |
| Gene Symbol |
sod1 |
| Predicted Species Reactivity |
Danio rerio|Zebrafish |
| Image 1 | |
|
