| Product Number |
OPCA04582 |
| Product Page |
www.avivasysbio.com/larval-cuticle-protein-a1a-recombinant-protein-yellow-mealworm-beetle-opca04582.html |
| Name |
LARVAL CUTICLE PROTEIN A1A Recombinant Protein (Yellow mealworm beetle) (OPCA04582) |
| Protein Size (# AA) |
Recombinant amino acids |
| Molecular Weight |
24.7 kDa |
| Tag |
N-terminal 10xHis-B2M-JD-tagged and C-terminal Myc-tagged |
| Purity |
Greater than 90% as determined by SDS-PAGE. |
| Source |
E.coli |
| Protein Range |
1-174 aa |
| Alias Symbols |
TM-LCP A1A. |
| Peptide Sequence |
GLVGAPATLSTAPIAYGGYGGYGAYGGSLLRAAPIARVASPLAYAAPVARVAAPLAYAAPYARAAVAAPVAVAKTVVADEYDPNPQYSFGYDVQDGLTGDSKNQVESRSGDVVQGSYSLVDPDGTRRTVEYTADPINGFNAVVHREPLVAKAVVAAPAIAKVHAPLAYSGGYLH |
| Product Format |
Liquid or Lyophilized powder |
| Reference |
Sequence studies of proteins from larval and pupal cuticle of the yellow meal worm, Tenebrio molitor.Andersen S.O., Rafn K., Roepstorff P.Insect Biochem. Mol. Biol. 27:121-131(1997) |
| Description of Target |
Component of the cuticle of the larva of Tenebrio molitor. |
| Reconstitution and Storage |
-20°C or -80°C |
| Protein Sequence |
GLVGAPATLSTAPIAYGGYGGYGAYGGSLLRAAPIARVASPLAYAAPVARVAAPLAYAAPYARAAVAAPVAVAKTVVADEYDPNPQYSFGYDVQDGLTGDSKNQVESRSGDVVQGSYSLVDPDGTRRTVEYTADPINGFNAVVHREPLVAKAVVAAPAIAKVHAPLAYSGGYLH |
| Datasheets/Manuals |
Printable datasheet for LARVAL CUTICLE PROTEIN A1A Recombinant Protein (Yellow mealworm beetle) (OPCA04582) (OPCA04582) |
| Additional Information |
Species Specificity Detail: Tenebrio molitor (Yellow mealworm beetle) |
| Formulation |
Tris-base, 50% glycerol |
| Storage Buffer |
If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol.
If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
| Uniprot ID |
P80681 |
| Protein Name |
Larval cuticle protein A1A |
| Predicted Species Reactivity |
Tenebrio molitor |
| Image 1 | |
|
