| Product Number |
OPCA04446 |
| Product Page |
www.avivasysbio.com/omp-recombinant-protein-rickettsia-japonica-opca04446.html |
| Name |
OMP Recombinant Protein (Rickettsia japonica) (OPCA04446) |
| Protein Size (# AA) |
Recombinant amino acids |
| Molecular Weight |
30.5 kDa |
| Tag |
N-terminal 6xHis-SUMO-tagged |
| Purity |
Greater than 90% as determined by SDS-PAGE. |
| Source |
E.coli |
| Protein Range |
20-159 aa |
| Alias Symbols |
omp, RJP_094417 kDa surface antigen |
| Peptide Sequence |
CNGPGGMNKQGTGTLLGGAGGALLGSQFGKGTGQLVGVGVGALLGAVLGGQIGAGMDEQDRRLAELTSQRALETAPSGSNVEWRNPDNGNYGYVTPNKTYRNSTGQYCREYTQTVVIGGKQQKAYGNACRQPDGQWQVVN |
| Product Format |
Liquid or Lyophilized powder |
| Reference |
Specific amplification of Rickettsia japonica DNA from clinical specimens by PCR.Furuya Y., Katayama T., Yoshida Y., Kaiho I.J. Clin. Microbiol. 33:487-489(1995) |
| Reconstitution and Storage |
-20°C or -80°C |
| Protein Sequence |
CNGPGGMNKQGTGTLLGGAGGALLGSQFGKGTGQLVGVGVGALLGAVLGGQIGAGMDEQDRRLAELTSQRALETAPSGSNVEWRNPDNGNYGYVTPNKTYRNSTGQYCREYTQTVVIGGKQQKAYGNACRQPDGQWQVVN |
| Datasheets/Manuals |
Printable datasheet for OMP Recombinant Protein (Rickettsia japonica) (OPCA04446) (OPCA04446) |
| Additional Information |
Species Specificity Detail: Rickettsia japonica (strain ATCC VR-1363 / YH) |
| Formulation |
Tris-base, 50% glycerol |
| Storage Buffer |
If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol.
If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
| Uniprot ID |
Q52764 |
| Protein Name |
17 kDa surface antigen |
| Gene Symbol |
OMP |
| Predicted Species Reactivity |
Rickettsia japonica |
| Image 1 | |
|
