| Product Number |
OPCA04276 |
| Product Page |
www.avivasysbio.com/h1f0-a-recombinant-protein-african-clawed-frog-opca04276.html |
| Name |
H1F0-A Recombinant Protein (African clawed frog) (OPCA04276) |
| Protein Size (# AA) |
Recombinant amino acids |
| Molecular Weight |
37 kDa |
| Tag |
N-terminal 6xHis-SUMO-tagged |
| NCBI Gene Id |
398662 |
| Purity |
Greater than 90% as determined by SDS-PAGE. |
| Source |
E.coli |
| Gene Full Name |
H1.0 linker histone L homeolog |
| Protein Range |
1-194 aa |
| Alias Symbols |
H1 histone family member 0 L homeolog;H1 histone family, member 0;h1(0)-1;h10;h1-0-a;H1E;h1f0;h1f0.L;h1f0-a;h1f0-b;h1fv;H1-SB;H1zero;histone H1(0)-1;histone H1.0-A;histone H5B;XELAEV_18023705mg;xlH5B. |
| Peptide Sequence |
MTENSAPAAKPRRSKASKKSTDHPKYSDMILDAVQAEKSRSGSSRQSIQKYIKNNYTVGENADSQIKLSIKRLVTSGTLKQTKGVGASGSFRLAKADEVKKPAKKPKKEIKKAVSPKKAAKPKKAAKSPAKAKKPKVAEKKVKKAPKKKPAPSPRKAKKTKTVRAKPVWASKAKKAKPSKPKAKASPKKSGRKK |
| Product Format |
Liquid or Lyophilized powder |
| Reference |
Characterization of the two H1(0)-encoding genes from Xenopus laevis.Brocard M., Triebe S., Peretti M., Doenecke D., Khochbin S.Gene 189:127-134(1997) |
| Description of Target |
Histones H1 are necessary for the condensation of nucleosome chains into higher-order structures. The H1F0 histones are found in cells that are in terminal stages of differentiation or that have low rates of cell division (By similarity). |
| Reconstitution and Storage |
-20°C or -80°C |
| Protein Sequence |
MTENSAPAAKPRRSKASKKSTDHPKYSDMILDAVQAEKSRSGSSRQSIQKYIKNNYTVGENADSQIKLSIKRLVTSGTLKQTKGVGASGSFRLAKADEVKKPAKKPKKEIKKAVSPKKAAKPKKAAKSPAKAKKPKVAEKKVKKAPKKKPAPSPRKAKKTKTVRAKPVWASKAKKAKPSKPKAKASPKKSGRKK |
| Datasheets/Manuals |
Printable datasheet for H1F0-A Recombinant Protein (African clawed frog) (OPCA04276) (OPCA04276) |
| Additional Information |
Species Specificity Detail: Xenopus laevis (African clawed frog) |
| Formulation |
Tris-base, 50% glycerol |
| Storage Buffer |
If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol.
If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
| Uniprot ID |
P22845 |
| Protein Name |
Histone H1.0-A |
| Protein Accession # |
NP_001082697 |
| Nucleotide Accession # |
NM_001089228 |
| Gene Symbol |
h1-0.L |
| Predicted Species Reactivity |
Xenopus laevis |
| Image 1 | |
|
