| Product Number |
OPCA04188 |
| Product Page |
www.avivasysbio.com/glutathione-s-transferase-recombinant-protein-german-cockroach-opca04188.html |
| Name |
GLUTATHIONE S-TRANSFERASE Recombinant Protein (German cockroach) (OPCA04188) |
| Protein Size (# AA) |
Recombinant amino acids |
| Molecular Weight |
39.2 kDa |
| Tag |
N-terminal 6xHis-SUMO-tagged |
| Purity |
Greater than 90% as determined by SDS-PAGE. |
| Source |
E.coli |
| Protein Range |
2-204 aa |
| Alias Symbols |
GST class-sigma;Major allergen Bla g 5. |
| Peptide Sequence |
APSYKLTYCPVKALGEPIRFLLSYGEKDFEDYRFQEGDWPNLKPSMPFGKTPVLEIDGKQTHQSVAISRYLGKQFGLSGKDDWENLEIDMIVDTISDFRAAIANYHYDADENSKQKKWDPLKKETIPYYTKKFDEVVKANGGYLAAGKLTWADFYFVAILDYLNHMAKEDLVANQPNLKALREKVLGLPAIKAWVAKRPPTDL |
| Product Format |
Liquid or Lyophilized powder |
| Reference |
Induction of IgE antibody responses by glutathione S-transferase from the German cockroach (Blattella germanica).Arruda L.K., Vailes L.D., Platts-Mills T.A.E., Hayden M.L., Chapman M.D.J. Biol. Chem. 272:20907-20912(1997) |
| Description of Target |
RX + glutathione = HX + R-S-glutathione. |
| Reconstitution and Storage |
-20°C or -80°C |
| Protein Sequence |
APSYKLTYCPVKALGEPIRFLLSYGEKDFEDYRFQEGDWPNLKPSMPFGKTPVLEIDGKQTHQSVAISRYLGKQFGLSGKDDWENLEIDMIVDTISDFRAAIANYHYDADENSKQKKWDPLKKETIPYYTKKFDEVVKANGGYLAAGKLTWADFYFVAILDYLNHMAKEDLVANQPNLKALREKVLGLPAIKAWVAKRPPTDL |
| Datasheets/Manuals |
Printable datasheet for GLUTATHIONE S-TRANSFERASE Recombinant Protein (German cockroach) (OPCA04188) (OPCA04188) |
| Additional Information |
Species Specificity Detail: Blattella germanica (German cockroach) (Blatta germanica) |
| Formulation |
Tris-base, 50% glycerol |
| Storage Buffer |
If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol.
If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
| Uniprot ID |
O18598 |
| Protein Name |
Glutathione S-transferase |
| Predicted Species Reactivity |
Blattella germanica |
| Image 1 | GLUTATHIONE S-TRANSFERASE Recombinant Protein (German cockroach) (OPCA04188)
 | |
|
|
