Product Number |
OPCA03678 |
Product Page |
www.avivasysbio.com/cr2-recombinant-protein-mouse-opca03678.html |
Name |
CR2 Recombinant Protein (Mouse) (OPCA03678) |
Protein Size (# AA) |
Recombinant amino acids |
Molecular Weight |
18.7 kDa |
Tag |
N-terminal 6xHis-tagged |
Host |
Mouse |
Purity |
Greater than 90% as determined by SDS-PAGE. |
Source |
Mammalian Cells |
Protein Range |
12-145 aa |
Alias Symbols |
Complement C3d receptor. |
Peptide Sequence |
ISCDPPPEVKNARKPYYSLPIVPGTVLRYTCSPSYRLIGEKAIFCISENQVHATWDKAPPICESVNKTISCSDPIVPGGFMNKGSKAPFRHGDSVTFTCKANFTMKGSKTVWCQANEMWGPTALPVCESDFPLE |
Product Format |
Liquid or Lyophilized powder |
Reference |
Comparative structure and evolution of murine CR2. The homolog of the human C3d/EBV receptor (CD21).Fingeroth J.D.J. Immunol. 144:3458-3467(1990) |
Description of Target |
Receptor for complement C3d and for HNRNPU. Participates in B lymphocytes activation. |
Reconstitution and Storage |
-20°C or -80°C |
Protein Sequence |
ISCDPPPEVKNARKPYYSLPIVPGTVLRYTCSPSYRLIGEKAIFCISENQVHATWDKAPPICESVNKTISCSDPIVPGGFMNKGSKAPFRHGDSVTFTCKANFTMKGSKTVWCQANEMWGPTALPVCESDFPLE |
Datasheets/Manuals |
Printable datasheet for CR2 Recombinant Protein (Mouse) (OPCA03678) (OPCA03678) |
Additional Information |
Relevance: Receptor for complement C3d. Participates in B lymphocytes activation. |
Formulation |
20 mM Tris-HCl based buffer, pH 8.0 |
Storage Buffer |
If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol.
If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
Uniprot ID |
P19070 |
Protein Name |
Complement receptor type 2 |
Gene Symbol |
CR2 |
Predicted Species Reactivity |
Mouse|Mus musculus |
Image 1 | CR2 Recombinant Protein (Mouse) (OPCA03678)
| |
|
|