| Product Number |
OPCA03638 |
| Product Page |
www.avivasysbio.com/fcgrt-recombinant-protein-human-opca03638.html |
| Name |
FCGRT Recombinant Protein (Human) (OPCA03638) |
| Protein Size (# AA) |
Recombinant amino acids |
| Molecular Weight |
34.4 kDa |
| Tag |
N-terminal 6xHis-tagged |
| NCBI Gene Id |
2217 |
| Host |
Human |
| Purity |
Greater than 90% as determined by SDS-PAGE. |
| Source |
Mammalian Cells |
| Gene Full Name |
Fc fragment of IgG receptor and transporter |
| Protein Range |
24-297 aa |
| Alias Symbols |
alpha-chain;Fc fragment of IgG, receptor, transporter, alpha;FCRN;FcRn alpha chain;heavy chain of the major histocompatibility complex class I-like Fc receptor;IgG Fc fragment receptor transporter alpha chain;IgG receptor FcRn large subunit p51;immunoglobulin receptor, intestinal, heavy chain;major histocompatibility complex class I-like Fc receptor;neonatal Fc receptor;neonatal Fc-receptor for Ig;transmembrane alpha chain of the neonatal receptor. |
| Peptide Sequence |
AESHLSLLYHLTAVSSPAPGTPAFWVSGWLGPQQYLSYNSLRGEAEPCGAWVWENQVSWYWEKETTDLRIKEKLFLEAFKALGGKGPYTLQGLLGCELGPDNTSVPTAKFALNGEEFMNFDLKQGTWGGDWPEALAISQRWQQQDKAANKELTFLLFSCPHRLREHLERGRGNLEWKEPPSMRLKARPSSPGFSVLTCSAFSFYPPELQLRFLRNGLAAGTGQGDFGPNSDGSFHASSSLTVKSGDEHHYCCIVQHAGLAQPLRVELESPAKSS |
| Product Format |
Liquid or Lyophilized powder |
| Reference |
The full-ORF clone resource of the German cDNA consortium.Bechtel S., Rosenfelder H., Duda A., Schmidt C.P., Ernst U., Wellenreuther R., Mehrle A., Schuster C., Bahr A., Bloecker H., Heubner D., Hoerlein A., Michel G., Wedler H., Koehrer K., Ottenwaelder B., Poustka A., Wiemann S., Schupp I.BMC Genomics 8:399-399(2007) |
| Description of Target |
Binds to the Fc region of monomeric immunoglobulins gamma (PubMed:7964511, PubMed:10933786). Mediates the selective uptake of IgG from milk and helps newborn animals to acquire passive immunity. IgG in the milk is bound at the apical surface of the intestinal epithelium. The resultant FcRn-IgG complexes are transcytosed across the intestinal epithelium and IgG is released from FcRn into blood or tissue fluids (By similarity). Possible role in transfer of immunoglobulin G from mother to fetus (PubMed:7964511). |
| Reconstitution and Storage |
-20°C or -80°C |
| Protein Sequence |
AESHLSLLYHLTAVSSPAPGTPAFWVSGWLGPQQYLSYNSLRGEAEPCGAWVWENQVSWYWEKETTDLRIKEKLFLEAFKALGGKGPYTLQGLLGCELGPDNTSVPTAKFALNGEEFMNFDLKQGTWGGDWPEALAISQRWQQQDKAANKELTFLLFSCPHRLREHLERGRGNLEWKEPPSMRLKARPSSPGFSVLTCSAFSFYPPELQLRFLRNGLAAGTGQGDFGPNSDGSFHASSSLTVKSGDEHHYCCIVQHAGLAQPLRVELESPAKSS |
| Datasheets/Manuals |
Printable datasheet for FCGRT Recombinant Protein (Human) (OPCA03638) (OPCA03638) |
| Additional Information |
Relevance: Binds to the Fc region of monomeric immunoglobulins gamma. Mediates the uptake of IgG from milk. Possible role in transfer of immunoglobulin G from mother to fetus. |
| Formulation |
20 mM Tris-HCl based buffer, pH 8.0 |
| Storage Buffer |
If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol.
If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
| Uniprot ID |
P55899 |
| Protein Name |
IgG receptor FcRn large subunit p51 |
| Protein Accession # |
NP_001129491.1
|
| Nucleotide Accession # |
NM_001136019.2 |
| Gene Symbol |
FCGRT |
| Predicted Species Reactivity |
Homo sapiens|Human |
| Image 1 | Protein SDS-PAGE
 | FCGRT Recombinant Protein (Human) (OPCA03638) in SDS-PAGE showing the molecular weight of approximately 34.9 kDa. |
|
