UBE3A Recombinant Protein (Mouse) (OPCA03595)

• Product Number: OPCA03595
• Name: UBE3A Recombinant Protein (Mouse) (OPCA03595)
• Protein Size (# AA): Recombinant amino acids
• Molecular Weight: 41.9 kDa
• Tag: N-terminal 6xHis-tagged
• NCBI Gene Id: 22215
• Host: Mouse
• Purity: Greater than 90% as determined by SDS-PAGE.
• Source: E.coli
• Gene Full Name: ubiquitin protein ligase E3A
• Protein Range: 542-870 aa
• Alias Symbols: 4732496B02;5830462N02Rik;A130086L21Rik;E6-AP ubiquitin protein ligase;HECT-type ubiquitin transferase E3A;Hpv;Hpve6a;oncogenic protein-associated protein E6-AP;ubiquitin conjugating enzyme E3A;ubiquitin-protein ligase E3A.
• Peptide Sequence: NPADLKKQLYVEFEGEQGVDEGGVSKEFFQLVVEEIFNPDIGMFTYDEATKLFWFNPSSFETEGQFTLIGIVLGLAIYNNCILDVHFPMVVYRKLMGKKGTFRDLGDSHPVLYQSLKDLLEYEGSVEDDMMITFQISQTDLFGNPMMYDLKENGDKIPITNENRKEFVNLYSDYILNKSVEKQFKAFRRGFHMVTNESPLKYLFRPEEIELLICGSRNLDFQALEETTEYDGGYTRESVVIREFWEIVHSFTDEQKRLFLQFTTGTDRAPVGGLGKLKMIIAKNGPDTERLPTSHTCFNVLLLPEYSSKEKLKERLLKAITYAKGFGML
• Product Format: Liquid or Lyophilized powder
• Reference: Subcellular localization and ubiquitin-conjugating enzyme (E2) interactions of mammalian HECT family ubiquitin protein ligases.Hatakeyama S., Jensen J.P., Weissman A.M.J. Biol. Chem. 272:15085-15092(1997)
• Description of Target: E3 ubiquitin-protein ligase which accepts ubiquitin from an E2 ubiquitin-conjugating enzyme in the form of a thioester and transfers it to its substrates. Several substrates have been identified including the ARNTL/BMAL1, ARC, RAD23A and RAD23B, MCM7 (which is involved in DNA replication), annexin A1, the PML tumor suppressor, and the cell cycle regulator CDKN1B (PubMed:20211139, PubMed:24728990). Additionally, may function as a cellular quality control ubiquitin ligase by helping the degradation of the cytoplasmic misfolded proteins. Finally, UBE3A also promotes its own degradation in vivo (By similarity). Plays an important role in the regulation of the circadian clock: involved in the ubiquitination of the core clock component ARNTL/BMAL1, leading to its proteasomal degradation (PubMed:24728990). Acts as a regulator of synaptic development by mediating ubiquitination and degradation of ARC (PubMed:20211139). Synergizes with WBP2 in enhancing PGR activity (By similarity).
• Reconstitution and Storage: -20°C or -80°C
• Protein Sequence: NPADLKKQLYVEFEGEQGVDEGGVSKEFFQLVVEEIFNPDIGMFTYDEATKLFWFNPSSFETEGQFTLIGIVLGLAIYNNCILDVHFPMVVYRKLMGKKGTFRDLGDSHPVLYQSLKDLLEYEGSVEDDMMITFQISQTDLFGNPMMYDLKENGDKIPITNENRKEFVNLYSDYILNKSVEKQFKAFRRGFHMVTNESPLKYLFRPEEIELLICGSRNLDFQALEETTEYDGGYTRESVVIREFWEIVHSFTDEQKRLFLQFTTGTDRAPVGGLGKLKMIIAKNGPDTERLPTSHTCFNVLLLPEYSSKEKLKERLLKAITYAKGFGML
• Additional Information: Relevance: E3 ubiquitin-protein ligase which accepts ubiquitin from an E2 ubiquitin-conjugating enzyme in the form of a thioester and transfers it to its substrates. Several substrates have been identified including the RAD23A and RAD23B, MCM7 (which is involved in DNA replication), annexin A1, the PML tumor suppressor, and the cell cycle regulator CDKN1B. Additionally, may function as a cellular quality control ubiquitin ligase by helping the degradation of the cytoplasmic misfolded proteins. Finally, UBE3A also promotes its own degradation in vivo (By similarity). Plays an important role in the regulation of the circadian clock: involved in the ubiquitination of the core clock component ARNTL/BMAL1, leading to its proteasomal degradation (PubMed:24728990).
• Formulation: 20 mM Tris-HCl based buffer, pH 8.0
• Storage Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
• Uniprot ID: O08759
• Protein Name: Ubiquitin-protein ligase E3A
• Gene Symbol: Ube3a
• Predicted Species Reactivity: Mouse|Mus musculus
• Image 1: UBE3A Recombinant Protein (Mouse) (OPCA03595)