2S albumin Recombinant Protein (European hazel) (OPCA03528)

Data Sheet
 
Product Number OPCA03528
Product Page www.avivasysbio.com/2s-albumin-recombinant-protein-european-hazel-opca03528.html
Name 2S albumin Recombinant Protein (European hazel) (OPCA03528)
Protein Size (# AA) Recombinant amino acids
Molecular Weight 30.9 kDa
Tag N-terminal 6xHis-SUMO-tagged
Host Corylus avellana
Purity Greater than 90% as determined by SDS-PAGE.
Source E.coli
Protein Range 23-147 aa
Peptide Sequence FRTTITTVDVDEDIVNQQGRRGESCREQAQRQQNLNQCQRYMRQQSQYGSYDGSNQQQQQELEQCCQQLRQMDERCRCEGLRQAVMQQQGEMRGEEMREVMETARDLPNQCRLSPQRCEIRSARF
Product Format Liquid or Lyophilized powder
Reference Isolation, cloning, and characterization of 2S albumin, a new hazelnut allergen.Garino C., Zuidmeer L., Marsh J., Morati M., Versteeg S., Brettlova V., Schilte P., Shewry P., Arlorio M., van Ree R.Submitted (OCT-2008)
Reconstitution and Storage -20°C or -80°C
Protein Sequence FRTTITTVDVDEDIVNQQGRRGESCREQAQRQQNLNQCQRYMRQQSQYGSYDGSNQQQQQELEQCCQQLRQMDERCRCEGLRQAVMQQQGEMRGEEMREVMETARDLPNQCRLSPQRCEIRSARF
Datasheets/Manuals Printable datasheet for 2S albumin Recombinant Protein (European hazel) (OPCA03528) (OPCA03528)
Formulation 20 mM Tris-HCl based buffer, pH 8.0
Storage Buffer If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Uniprot ID D0PWG2
Protein Name 2S albumin
Predicted Species Reactivity Corylus avellana
Image 1

 

AVIVA SYSTEMS BIOLOGY manufactures and sells quality antibody products covering genome wide proteins.

AVIVA SYSTEMS BIOLOGY
10211 Pacific Mesa Blvd, Ste 401, San Diego, CA 92121 USA | Tel: (858)552-6979 | info@avivasysbio.com