Product Number |
OPCA03528 |
Product Page |
www.avivasysbio.com/2s-albumin-recombinant-protein-european-hazel-opca03528.html |
Name |
2S albumin Recombinant Protein (European hazel) (OPCA03528) |
Protein Size (# AA) |
Recombinant amino acids |
Molecular Weight |
30.9 kDa |
Tag |
N-terminal 6xHis-SUMO-tagged |
Host |
Corylus avellana |
Purity |
Greater than 90% as determined by SDS-PAGE. |
Source |
E.coli |
Protein Range |
23-147 aa |
Peptide Sequence |
FRTTITTVDVDEDIVNQQGRRGESCREQAQRQQNLNQCQRYMRQQSQYGSYDGSNQQQQQELEQCCQQLRQMDERCRCEGLRQAVMQQQGEMRGEEMREVMETARDLPNQCRLSPQRCEIRSARF |
Product Format |
Liquid or Lyophilized powder |
Reference |
Isolation, cloning, and characterization of 2S albumin, a new hazelnut allergen.Garino C., Zuidmeer L., Marsh J., Morati M., Versteeg S., Brettlova V., Schilte P., Shewry P., Arlorio M., van Ree R.Submitted (OCT-2008) |
Reconstitution and Storage |
-20°C or -80°C |
Protein Sequence |
FRTTITTVDVDEDIVNQQGRRGESCREQAQRQQNLNQCQRYMRQQSQYGSYDGSNQQQQQELEQCCQQLRQMDERCRCEGLRQAVMQQQGEMRGEEMREVMETARDLPNQCRLSPQRCEIRSARF |
Datasheets/Manuals |
Printable datasheet for 2S albumin Recombinant Protein (European hazel) (OPCA03528) (OPCA03528) |
Formulation |
20 mM Tris-HCl based buffer, pH 8.0 |
Storage Buffer |
If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol.
If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
Uniprot ID |
D0PWG2 |
Protein Name |
2S albumin |
Predicted Species Reactivity |
Corylus avellana |
Image 1 | |
|