| Product Number |
OPCA03473 |
| Product Page |
www.avivasysbio.com/calca-recombinant-protein-dog-opca03473.html |
| Name |
CALCA Recombinant Protein (Dog) (OPCA03473) |
| Protein Size (# AA) |
Recombinant amino acids |
| Molecular Weight |
19.4 kDa |
| Tag |
N-terminal 6xHis-SUMO-tagged |
| NCBI Gene Id |
403946 |
| Host |
Dog |
| Purity |
Greater than 90% as determined by SDS-PAGE. |
| Source |
E.coli |
| Gene Full Name |
calcitonin related polypeptide alpha |
| Protein Range |
85-116 aa |
| Alias Symbols |
alpha-type CGRP;CALC;calcitonin;calcitonin gene-related peptide 1;calcitonin gene-related peptide I;calcitonin/calcitonin-related polypeptide, alpha;CCALCI;CGRP-I;prepro-alpha-calcitonin gene-related peptide. |
| Peptide Sequence |
CSNLSTCVLGTYSKDLNNFHTFSGIGFGAETP |
| Product Format |
Liquid or Lyophilized powder |
| Reference |
Molecular analysis and chromosomal assignment of the canine CALC-I/alpha-CGRP gene.Wende S., Krempler A., Breen M., Brunnberg L., Brenig B.Mamm. Genome 11:736-740(2000) |
| Description of Target |
Causes a rapid but short-lived drop in the level of calcium and phosphate in blood by promoting the incorporation of those ions in the bones. |
| Reconstitution and Storage |
-20°C or -80°C |
| Protein Sequence |
CSNLSTCVLGTYSKDLNNFHTFSGIGFGAETP |
| Datasheets/Manuals |
Printable datasheet for CALCA Recombinant Protein (Dog) (OPCA03473) (OPCA03473) |
| Additional Information |
Relevance: Causes a rapid but short-lived drop in the level of calcium and phosphate in blood by promoting the incorporation of those ions in the bones. |
| Formulation |
20 mM Tris-HCl based buffer, pH 8.0 |
| Storage Buffer |
If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol.
If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
| Uniprot ID |
P41547 |
| Protein Name |
Calcitonin |
| Gene Symbol |
CALCA |
| Predicted Species Reactivity |
Canis lupus|Dog |
| Image 1 | Protein SDS-PAGE
 | CALCA Recombinant Protein (Dog) (OPCA03473) in SDS-PAGE showing the molecular weight of approximately 19.38 kDa. |
|
|
