| Product Number |
OPCA03440 |
| Product Page |
www.avivasysbio.com/parvalbumin-beta-recombinant-protein-atlantic-cod-opca03440.html |
| Name |
Parvalbumin beta Recombinant Protein (Atlantic cod) (OPCA03440) |
| Protein Size (# AA) |
Recombinant amino acids |
| Molecular Weight |
27.4 kDa |
| Tag |
N-terminal 6xHis-SUMO-tagged |
| Host |
Gadus morhua |
| Purity |
Greater than 90% as determined by SDS-PAGE. |
| Source |
E.coli |
| Protein Range |
2-109 aa |
| Alias Symbols |
Allergen: Gad m 1 |
| Peptide Sequence |
AFAGILNDADITAALAACKAEGSFDHKAFFTKVGLAAKSPADIKKVFEIIDQDKSDFVEEDELKLFLQNFSAGARALSDAETKVFLKAGDSDGDGKIGVDEFGAMIKA |
| Product Format |
Liquid or Lyophilized powder |
| Reference |
The major allergen (parvalbumin) of codfish is encoded by at least two isotypic genes: cDNA cloning, expression and antibody binding of the recombinant allergens.Van Do T., Hordvik I., Endresen C., Elsayed S.Mol. Immunol. 39:595-602(2003) |
| Description of Target |
In muscle, parvalbumin is thought to be involved in relaxation after contraction. It binds two calcium ions (By similarity). |
| Reconstitution and Storage |
-20°C or -80°C |
| Protein Sequence |
Full Length of Mature Protein: AFAGILNDADITAALAACKAEGSFDHKAFFTKVGLAAKSPADIKKVFEIIDQDKSDFVEEDELKLFLQNFSAGARALSDAETKVFLKAGDSDGDGKIGVDEFGAMIKA |
| Datasheets/Manuals |
Printable datasheet for Parvalbumin beta Recombinant Protein (Atlantic cod) (OPCA03440) (OPCA03440) |
| Uniprot ID |
Q90YK9 |
| Protein Name |
Parvalbumin beta |
| Purification |
Affinity purified using IMAC. |
| Predicted Species Reactivity |
Atlantic Cod|Gadus morhua |
| Image 1 | Protein SDS-PAGE
 | Parvalbumin beta Recombinant Protein (Gadus morhua) (OPCA03440) in SDS-PAGE showing the molecular weight of approximately 27.41 kDa. |
|
|
