Product Number |
OPCA03258 |
Product Page |
www.avivasysbio.com/mt2731-recombinant-protein-mycobacterium-tuberculosis-opca03258.html |
Name |
MT2731 Recombinant Protein (Mycobacterium tuberculosis) (OPCA03258) |
Protein Size (# AA) |
Recombinant amino acids |
Molecular Weight |
9.7 kDa |
Tag |
N-terminal 6xHis-tagged |
Host |
Mycobacterium tuberculosis |
Purity |
Greater than 90% as determined by SDS-PAGE. |
Source |
Yeast |
Alias Symbols |
MT2731, Antitoxin MT2731 |
Peptide Sequence |
MSGHALAARTLLAAADELVGGPPVEASAAALAGDAAGAWRTAAVELARALVRAVAESHGVAAVLFAATAAAAAAVDRGDPP |
Product Format |
Liquid or Lyophilized powder |
Reference |
Whole-genome comparison of Mycobacterium tuberculosis clinical and laboratory strains.Fleischmann R.D., Alland D., Eisen J.A., Carpenter L., White O., Peterson J.D., DeBoy R.T., Dodson R.J., Gwinn M.L., Haft D.H., Hickey E.K., Kolonay J.F., Nelson W.C., Umayam L.A., Ermolaeva M.D., Salzberg S.L., Delcher A., Utterback T.R. Fraser C.M.J. Bacteriol. 184:5479-5490(2002) |
Description of Target |
Antitoxin component of a type II toxin-antitoxin (TA) system. Neutralizes the effect of cognate toxin MT2730 (By similarity). |
Reconstitution and Storage |
-20°C or -80°C |
Protein Sequence |
Full Length: MSGHALAARTLLAAADELVGGPPVEASAAALAGDAAGAWRTAAVELARALVRAVAESHGVAAVLFAATAAAAAAVDRGDPP |
Datasheets/Manuals |
Printable datasheet for MT2731 Recombinant Protein (Mycobacterium tuberculosis) (OPCA03258) (OPCA03258) |
Uniprot ID |
P9WJ10 |
Protein Name |
Antitoxin MT2731 |
Protein Accession # |
WP_003899415.1
|
Purification |
Affinity purified using IMAC |
Nucleotide Accession # |
NZ_KK341227.1 |
Gene Symbol |
MT2731 |
Predicted Species Reactivity |
Mycobacterium tuberculosis |
Image 1 | Protein SDS-PAGE
 | MT2731 Recombinant Protein (Mycobacterium tuberculosis) (OPCA03258) in SDS-PAGE showing the molecular weight of approximately 9.7 kDa. |
|
|