Product Number |
OPCA03248 |
Product Page |
www.avivasysbio.com/ypt1-recombinant-protein-baker-s-yeast-opca03248.html |
Name |
YPT1 Recombinant Protein (Baker's yeast) (OPCA03248) |
Protein Size (# AA) |
Recombinant amino acids |
Molecular Weight |
25.2 kDa |
Tag |
N-terminal 6xHis-tagged |
NCBI Gene Id |
850505 |
Host |
Yeast |
Purity |
Greater than 90% as determined by SDS-PAGE. |
Source |
Yeast |
Gene Full Name |
Rab family GTPase YPT1 |
Protein Range |
1-206 aa |
Alias Symbols |
Protein YP2;Rab family GTPase YPT1;Rab GTPase YPT1;Transport GTPase YPT1;YFL038C. |
Peptide Sequence |
MNSEYDYLFKLLLIGNSGVGKSCLLLRFSDDTYTNDYISTIGVDFKIKTVELDGKTVKLQIWDTAGQERFRTITSSYYRGSHGIIIVYDVTDQESFNGVKMWLQEIDRYATSTVLKLLVGNKCDLKDKRVVEYDVAKEFADANKMPFLETSALDSTNVEDAFLTMARQIKESMSQQNLNETTQKKEDKGNVNLKGQSLTNTGGGCC |
Product Format |
Liquid or Lyophilized powder |
Reference |
Functional implications of genetic interactions between genes encoding small GTPases involved in vesicular transport in yeast.Yoo J.S., Grabowski R., Xing L., Trepte H.H., Schmitt H.D., Gallwitz D.Mol. Gen. Genet. 261:80-91(1999) |
Description of Target |
The small GTPases Rab are key regulators of intracellular membrane trafficking, from the formation of transport vesicles to their fusion with membranes. Rabs cycle between an inactive GDP-bound form and an active GTP-bound form that is able to recruit to membranes different set of downstream effectors directly responsible for vesicle formation, movement, tethering and fusion. YPT1 regulates the trafficking of secretory vesicles from the endoplasmic reticulum (ER) to the Golgi. Vesicular transport depends on shuttling of YPT1 between membrane and cytosol by GDI1, probably by recycling it to its membrane of origin after a vesicle fusion event. Plays a role in the initial events of the autophagic vacuole development which take place at specialized regions of the endoplasmic reticulum. Also involved in the recycling of membrane proteins. |
Reconstitution and Storage |
-20°C or -80°C |
Protein Sequence |
MNSEYDYLFKLLLIGNSGVGKSCLLLRFSDDTYTNDYISTIGVDFKIKTVELDGKTVKLQIWDTAGQERFRTITSSYYRGSHGIIIVYDVTDQESFNGVKMWLQEIDRYATSTVLKLLVGNKCDLKDKRVVEYDVAKEFADANKMPFLETSALDSTNVEDAFLTMARQIKESMSQQNLNETTQKKEDKGNVNLKGQSLTNTGGGCC |
Datasheets/Manuals |
Printable datasheet for YPT1 Recombinant Protein (Baker's yeast) (OPCA03248) (OPCA03248) |
Additional Information |
Relevance: The small GTPases Rab are key regulators of intracellular membrane trafficking, from the formation of transport vesicles to their fusion with membranes. Rabs cycle between an inactive GDP-bound form and an active GTP-bound form that is able to recruit to membranes different set of downstream effectors directly responsible for vesicle formation, movement, tethering and fusion. YPT1 regulates the trafficking of secretory vesicles from the endoplasmic reticulum (ER) to the Golgi. Vesicular transport depends on shuttling of YPT1 between membrane and cytosol by GDI1, probably by recycling it to its membrane of origin after a vesicle fusion event. Plays a role in the initial events of the autophagic vacuole development which take place at specialized regions of the endoplasmic reticulum. Also involved in the recycling of membrane proteins. |
Formulation |
20 mM Tris-HCl based buffer, pH 8.0 |
Storage Buffer |
If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol.
If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
Uniprot ID |
P01123 |
Protein Name |
GTP-binding protein YPT1 |
Protein Accession # |
NP_116615.1
|
Nucleotide Accession # |
NM_001179928.1 |
Gene Symbol |
YPT1 |
Predicted Species Reactivity |
Saccharomyces cerevisiae |
Image 1 | Protein SDS-PAGE
 | YPT1 Recombinant Protein (Yeast) (OPCA03248) in SDS-PAGE showing the molecular weight of approximately 25.21 kDa. |
|
|