YPT1 Recombinant Protein (Baker's yeast) (OPCA03248)

Data Sheet
 
Product Number OPCA03248
Product Page www.avivasysbio.com/ypt1-recombinant-protein-baker-s-yeast-opca03248.html
Name YPT1 Recombinant Protein (Baker's yeast) (OPCA03248)
Protein Size (# AA) Recombinant amino acids
Molecular Weight 25.2 kDa
Tag N-terminal 6xHis-tagged
NCBI Gene Id 850505
Host Yeast
Purity Greater than 90% as determined by SDS-PAGE.
Source Yeast
Gene Full Name Rab family GTPase YPT1
Protein Range 1-206 aa
Alias Symbols Protein YP2;Rab family GTPase YPT1;Rab GTPase YPT1;Transport GTPase YPT1;YFL038C.
Peptide Sequence MNSEYDYLFKLLLIGNSGVGKSCLLLRFSDDTYTNDYISTIGVDFKIKTVELDGKTVKLQIWDTAGQERFRTITSSYYRGSHGIIIVYDVTDQESFNGVKMWLQEIDRYATSTVLKLLVGNKCDLKDKRVVEYDVAKEFADANKMPFLETSALDSTNVEDAFLTMARQIKESMSQQNLNETTQKKEDKGNVNLKGQSLTNTGGGCC
Product Format Liquid or Lyophilized powder
Reference Functional implications of genetic interactions between genes encoding small GTPases involved in vesicular transport in yeast.Yoo J.S., Grabowski R., Xing L., Trepte H.H., Schmitt H.D., Gallwitz D.Mol. Gen. Genet. 261:80-91(1999)
Description of Target The small GTPases Rab are key regulators of intracellular membrane trafficking, from the formation of transport vesicles to their fusion with membranes. Rabs cycle between an inactive GDP-bound form and an active GTP-bound form that is able to recruit to membranes different set of downstream effectors directly responsible for vesicle formation, movement, tethering and fusion. YPT1 regulates the trafficking of secretory vesicles from the endoplasmic reticulum (ER) to the Golgi. Vesicular transport depends on shuttling of YPT1 between membrane and cytosol by GDI1, probably by recycling it to its membrane of origin after a vesicle fusion event. Plays a role in the initial events of the autophagic vacuole development which take place at specialized regions of the endoplasmic reticulum. Also involved in the recycling of membrane proteins.
Reconstitution and Storage -20°C or -80°C
Protein Sequence MNSEYDYLFKLLLIGNSGVGKSCLLLRFSDDTYTNDYISTIGVDFKIKTVELDGKTVKLQIWDTAGQERFRTITSSYYRGSHGIIIVYDVTDQESFNGVKMWLQEIDRYATSTVLKLLVGNKCDLKDKRVVEYDVAKEFADANKMPFLETSALDSTNVEDAFLTMARQIKESMSQQNLNETTQKKEDKGNVNLKGQSLTNTGGGCC
Datasheets/Manuals Printable datasheet for YPT1 Recombinant Protein (Baker's yeast) (OPCA03248) (OPCA03248)
Additional Information Relevance: The small GTPases Rab are key regulators of intracellular membrane trafficking, from the formation of transport vesicles to their fusion with membranes. Rabs cycle between an inactive GDP-bound form and an active GTP-bound form that is able to recruit to membranes different set of downstream effectors directly responsible for vesicle formation, movement, tethering and fusion. YPT1 regulates the trafficking of secretory vesicles from the endoplasmic reticulum (ER) to the Golgi. Vesicular transport depends on shuttling of YPT1 between membrane and cytosol by GDI1, probably by recycling it to its membrane of origin after a vesicle fusion event. Plays a role in the initial events of the autophagic vacuole development which take place at specialized regions of the endoplasmic reticulum. Also involved in the recycling of membrane proteins.
Formulation 20 mM Tris-HCl based buffer, pH 8.0
Storage Buffer If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Uniprot ID P01123
Protein Name GTP-binding protein YPT1
Protein Accession # NP_116615.1
Nucleotide Accession # NM_001179928.1
Gene Symbol YPT1
Predicted Species Reactivity Saccharomyces cerevisiae
Image 1
Protein SDS-PAGE
YPT1 Recombinant Protein (Yeast) (OPCA03248) in SDS-PAGE showing the molecular weight of approximately 25.21 kDa.
 

AVIVA SYSTEMS BIOLOGY manufactures and sells quality antibody products covering genome wide proteins.

AVIVA SYSTEMS BIOLOGY
6370 Nancy Ridge Dr., Suite 104, San Diego, CA 92121 USA | Tel: (858)552-6979 | info@avivasysbio.com