| Product Number |
OPCA03129 |
| Product Page |
www.avivasysbio.com/hyp2-recombinant-protein-baker-s-yeast-opca03129.html |
| Name |
HYP2 Recombinant Protein (Baker's yeast) (OPCA03129) |
| Protein Size (# AA) |
Recombinant amino acids |
| Molecular Weight |
33 kDa |
| Tag |
N-terminal 6xHis-SUMO-tagged |
| NCBI Gene Id |
856677 |
| Host |
Yeast |
| Purity |
Greater than 90% as determined by SDS-PAGE. |
| Source |
E.coli |
| Gene Full Name |
translation elongation factor eIF-5A |
| Protein Range |
2-157 aa |
| Alias Symbols |
eIF-4D;Hypusine-containing protein HP2;TIF51A;translation elongation factor eIF-5A;YEL034W. |
| Peptide Sequence |
SDEEHTFETADAGSSATYPMQCSALRKNGFVVIKSRPCKIVDMSTSKTGKHGHAKVHLVAIDIFTGKKLEDLSPSTHNMEVPVVKRNEYQLLDIDDGFLSLMNMDGDTKDDVKAPEGELGDSLQTAFDEGKDLMVTIISAMGEEAAISFKEAARTD |
| Product Format |
Liquid or Lyophilized powder |
| Reference |
Translation initiation factor 5A and its hypusine modification are essential for cell viability in the yeast Saccharomyces cerevisiae. Schnier J., Schwelberger H.G., Smit-Mcbride Z., Kang H.A., Hershey J.W.B.Mol. Cell. Biol. 11:3105-3114(1991) |
| Description of Target |
mRNA-binding protein involved in translation elongation. Has an important function at the level of mRNA turnover, probably acting downstream of decapping. Involved in actin dynamics and cell cycle progression, mRNA decay and probably in a pathway involved in stress response and maintenance of cell wall integrity. Essential for polarized growth, a process necessary for G1/S transition. May mediate large range of effects of the polyamine spermidine in the cell. |
| Reconstitution and Storage |
-20°C or -80°C |
| Protein Sequence |
SDEEHTFETADAGSSATYPMQCSALRKNGFVVIKSRPCKIVDMSTSKTGKHGHAKVHLVAIDIFTGKKLEDLSPSTHNMEVPVVKRNEYQLLDIDDGFLSLMNMDGDTKDDVKAPEGELGDSLQTAFDEGKDLMVTIISAMGEEAAISFKEAARTD |
| Datasheets/Manuals |
Printable datasheet for HYP2 Recombinant Protein (Baker's yeast) (OPCA03129) (OPCA03129) |
| Additional Information |
Relevance: mRNA-binding protein involved in translation elongation. Has an important function at the level of mRNA turnover, probably acting downstream of decapping. Involved in actin dynamics and cell cycle progression, mRNA decay and probably in a pathway involved in stress response and maintenance of cell wall integrity. Essential for polarized growth, a process necessary for G1/S transition. May mediate large range of effects of the polyamine spermidine in the cell. |
| Formulation |
20 mM Tris-HCl based buffer, pH 8.0 |
| Storage Buffer |
If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol.
If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
| Uniprot ID |
P23301 |
| Protein Name |
Eukaryotic translation initiation factor 5A-1 |
| Protein Accession # |
NP_010880.3
|
| Nucleotide Accession # |
NM_001178849.3 |
| Gene Symbol |
HYP2 |
| Predicted Species Reactivity |
Saccharomyces cerevisiae |
| Image 1 | Protein SDS-PAGE
 | HYP2 Recombinant Protein (Yeast) (OPCA03129) in SDS-PAGE showing the molecular weight of approximately 32.97 kDa. |
|
