| Product Number |
OPCA02963 |
| Product Page |
www.avivasysbio.com/nsp4-recombinant-protein-rv-a-opca02963.html |
| Name |
NSP4 Recombinant Protein (RV-A) (OPCA02963) |
| Protein Size (# AA) |
52-175 aa amino acids |
| Molecular Weight |
16.6 kDa |
| Tag |
N-terminal 6xHis-tagged |
| Purity |
Greater than 90% as determined by SDS-PAGE. |
| Concentration |
0.5 mg/ml (Varies by lot. See vial for exact concentration.) |
| Source |
Yeast |
| Protein Range |
52-175 aa |
| Alias Symbols |
Non-structural glycoprotein 4, NSP4, NCVP5, NS28 |
| Product Format |
Liquid or Lyophilized powder |
| Reference |
Group A human rotavirus genomics evidence that gene constellations are influenced by viral protein interactions.Heiman E.M., McDonald S.M., Barro M., Taraporewala Z.F., Bar-Magen T., Patton J.T.J. Virol. 82:11106-11116(2008) |
| Description of Target |
Plays an essential role in the virus replication cycle by acting as a viroporin. Creates a pore in the host reticulum endoplasmic and as a consequence releases Ca2+ in the cytoplasm of infected cell. In turn, high levels of cytoplasmic calcium trigger membrane trafficking and transport of viral ER-associated proteins to viroplasms, sites of viral genome replication and immature particle assembly. |
| Reconstitution and Storage |
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20C/-80C. Our default final concentration of glycerol is 50%. Customers could use it as reference.
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20C/-80C. The shelf life of lyophilized form is 12 months at -20C/-80C.
Repeated freezing and thawing is not recommended. Store working aliquots at 4C for up to one week. |
| Protein Sequence |
PTMKIALKASKCSYKVIKYCVVTIINTLLKLAGYKEQVTTKDEIEQQMDRIVKEMRRQLEMIDKLTTREIEQIELLKRIHDNLITRPVNVIDMSMEFNQKNIKTLDEWESRKNPYEPSEVTASM |
| Datasheets/Manuals |
Printable datasheet for NSP4 Recombinant Protein (Rotavirus A) (OPCA02963) |
| Additional Information |
Immunogen: Partial Protein |
| Storage Buffer |
If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol.
If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
| Uniprot ID |
Q82035 |
| Predicted Species Reactivity |
Rotavirus A |
| Image 1 | Protein SDS-PAGE
 | NSP4 Recombinant Protein (Rotavirus A) (OPCA02963) in SDS-PAGE showing the molecular weight of approximately 16.6 kDa. |
|
|
